Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3481577..3482195 | Replicon | chromosome |
Accession | NZ_CP099877 | ||
Organism | Escherichia albertii strain 247_2_EW_B |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NIZ22_RS17065 | Protein ID | WP_001280991.1 |
Coordinates | 3481977..3482195 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NIZ22_RS17060 | Protein ID | WP_256878553.1 |
Coordinates | 3481577..3481951 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ22_RS17050 (3476657) | 3476657..3477850 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NIZ22_RS17055 (3477873) | 3477873..3481022 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
NIZ22_RS17060 (3481577) | 3481577..3481951 | + | 375 | WP_256878553.1 | Hha toxicity modulator TomB | Antitoxin |
NIZ22_RS17065 (3481977) | 3481977..3482195 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NIZ22_RS17070 (3482372) | 3482372..3482929 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
NIZ22_RS17075 (3483036) | 3483036..3483506 | + | 471 | WP_000136188.1 | YlaC family protein | - |
NIZ22_RS17080 (3483670) | 3483670..3485219 | + | 1550 | Protein_3333 | EAL domain-containing protein | - |
NIZ22_RS17085 (3485257) | 3485257..3485610 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
NIZ22_RS17095 (3485991) | 3485991..3486302 | + | 312 | WP_000409915.1 | MGMT family protein | - |
NIZ22_RS17100 (3486332) | 3486332..3486904 | - | 573 | WP_256875765.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249626 WP_001280991.1 NZ_CP099877:3481977-3482195 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14455.34 Da Isoelectric Point: 5.1542
>AT249626 WP_256878553.1 NZ_CP099877:3481577-3481951 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|