Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 297102..297902 | Replicon | chromosome |
| Accession | NZ_CP099877 | ||
| Organism | Escherichia albertii strain 247_2_EW_B | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A8H9C5V7 |
| Locus tag | NIZ22_RS01370 | Protein ID | WP_000342455.1 |
| Coordinates | 297375..297902 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | NIZ22_RS01365 | Protein ID | WP_001277106.1 |
| Coordinates | 297102..297368 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ22_RS01345 (292698) | 292698..293756 | + | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
| NIZ22_RS01350 (294001) | 294001..294855 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| NIZ22_RS01355 (295052) | 295052..295561 | + | 510 | WP_059235675.1 | hypothetical protein | - |
| NIZ22_RS01360 (295849) | 295849..296952 | + | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NIZ22_RS01365 (297102) | 297102..297368 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NIZ22_RS01370 (297375) | 297375..297902 | + | 528 | WP_000342455.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NIZ22_RS01375 (297899) | 297899..298282 | - | 384 | WP_059235673.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NIZ22_RS01380 (298706) | 298706..299815 | + | 1110 | WP_256875830.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NIZ22_RS01385 (299863) | 299863..300789 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NIZ22_RS01390 (300786) | 300786..302063 | + | 1278 | WP_044709902.1 | branched chain amino acid ABC transporter permease LivM | - |
| NIZ22_RS01395 (302060) | 302060..302827 | + | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19607.47 Da Isoelectric Point: 6.6343
>T249614 WP_000342455.1 NZ_CP099877:297375-297902 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|