Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 19850..20375 Replicon plasmid plas2
Accession NZ_CP099876
Organism Escherichia albertii strain 251_2_EW_B

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NIZ23_RS23650 Protein ID WP_001159871.1
Coordinates 19850..20155 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag NIZ23_RS23655 Protein ID WP_000813639.1
Coordinates 20157..20375 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ23_RS23610 (NIZ23_23590) 14947..15234 - 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin -
NIZ23_RS23615 (NIZ23_23595) 15231..15482 - 252 WP_001139207.1 plasmid stabilization protein -
NIZ23_RS23620 (NIZ23_23600) 15597..16019 + 423 Protein_20 DUF4113 domain-containing protein -
NIZ23_RS23625 (NIZ23_23605) 16021..16437 - 417 WP_256875925.1 plasmid partitioning/stability family protein -
NIZ23_RS23630 (NIZ23_23610) 16430..17410 - 981 WP_256875926.1 plasmid segregation protein ParM -
NIZ23_RS23635 (NIZ23_23615) 17822..18130 - 309 WP_000030204.1 molecular chaperone GroEL -
NIZ23_RS23640 (NIZ23_23620) 18217..18861 - 645 WP_001144036.1 ParA family protein -
NIZ23_RS23645 (NIZ23_23625) 19041..19849 - 809 Protein_25 site-specific integrase -
NIZ23_RS23650 (NIZ23_23630) 19850..20155 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NIZ23_RS23655 (NIZ23_23635) 20157..20375 - 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIZ23_RS23660 (NIZ23_23640) 20972..21241 + 270 WP_000343793.1 hypothetical protein -
NIZ23_RS23665 (NIZ23_23645) 21229..21825 + 597 WP_059217960.1 hypothetical protein -
NIZ23_RS23670 (NIZ23_23650) 21885..22154 + 270 Protein_30 site-specific integrase -
NIZ23_RS23675 (NIZ23_23655) 22150..22335 - 186 Protein_31 transposase -
NIZ23_RS23680 (NIZ23_23660) 22422..22841 + 420 WP_065106474.1 transposase -
NIZ23_RS23685 (NIZ23_23665) 22838..23189 + 352 Protein_33 IS66 family insertion sequence element accessory protein TnpB -
NIZ23_RS23690 (NIZ23_23670) 23220..24814 + 1595 Protein_34 IS66 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeI / faeH / espL2 1..79680 79680


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T249611 WP_001159871.1 NZ_CP099876:c20155-19850 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT249611 WP_000813639.1 NZ_CP099876:c20375-20157 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References