Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 14947..15482 Replicon plasmid plas2
Accession NZ_CP099876
Organism Escherichia albertii strain 251_2_EW_B

Toxin (Protein)


Gene name relE Uniprot ID T2HS21
Locus tag NIZ23_RS23610 Protein ID WP_000222775.1
Coordinates 14947..15234 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID T2HSA2
Locus tag NIZ23_RS23615 Protein ID WP_001139207.1
Coordinates 15231..15482 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ23_RS23590 (NIZ23_23570) 10439..11203 - 765 WP_256875923.1 helix-turn-helix domain-containing protein -
NIZ23_RS23595 (NIZ23_23575) 12206..12799 + 594 WP_001523457.1 ProQ/FINO family protein -
NIZ23_RS23600 (NIZ23_23580) 13079..13665 - 587 Protein_16 serine acetyltransferase -
NIZ23_RS23605 (NIZ23_23585) 14566..14937 - 372 WP_256875924.1 hypothetical protein -
NIZ23_RS23610 (NIZ23_23590) 14947..15234 - 288 WP_000222775.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIZ23_RS23615 (NIZ23_23595) 15231..15482 - 252 WP_001139207.1 plasmid stabilization protein Antitoxin
NIZ23_RS23620 (NIZ23_23600) 15597..16019 + 423 Protein_20 DUF4113 domain-containing protein -
NIZ23_RS23625 (NIZ23_23605) 16021..16437 - 417 WP_256875925.1 plasmid partitioning/stability family protein -
NIZ23_RS23630 (NIZ23_23610) 16430..17410 - 981 WP_256875926.1 plasmid segregation protein ParM -
NIZ23_RS23635 (NIZ23_23615) 17822..18130 - 309 WP_000030204.1 molecular chaperone GroEL -
NIZ23_RS23640 (NIZ23_23620) 18217..18861 - 645 WP_001144036.1 ParA family protein -
NIZ23_RS23645 (NIZ23_23625) 19041..19849 - 809 Protein_25 site-specific integrase -
NIZ23_RS23650 (NIZ23_23630) 19850..20155 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NIZ23_RS23655 (NIZ23_23635) 20157..20375 - 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeI / faeH / espL2 1..79680 79680


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11142.17 Da        Isoelectric Point: 10.6261

>T249610 WP_000222775.1 NZ_CP099876:c15234-14947 [Escherichia albertii]
MTYTVKFRDDALREWLKLDKSVQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSHVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9216.45 Da        Isoelectric Point: 4.0927

>AT249610 WP_001139207.1 NZ_CP099876:c15482-15231 [Escherichia albertii]
MPSIILSDTSASVSELKKNPMATVSAGEGYPVAILNRNQPAFYCVPAELYERMLDAMDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB T2HS21

Antitoxin

Source ID Structure
AlphaFold DB A0A754EQ65

References