249586

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 7625..8123 Replicon plasmid plas2
Accession NZ_CP099873
Organism Escherichia albertii strain 253_2_EW_B

Toxin (Protein)


Gene name TsxA Uniprot ID A0A0K6A0X9
Locus tag NIZ24_RS23685 Protein ID WP_000702249.1
Coordinates 7857..8123 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID A0A3H7VMJ5
Locus tag NIZ24_RS23680 Protein ID WP_001450803.1
Coordinates 7625..7867 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ24_RS23635 (NIZ24_23615) 2841..3179 - 339 WP_000753495.1 hypothetical protein -
NIZ24_RS23640 (NIZ24_23620) 3524..3946 + 423 WP_256878448.1 hypothetical protein -
NIZ24_RS23645 (NIZ24_23625) 3943..4485 + 543 WP_238896424.1 conjugal transfer protein TraL -
NIZ24_RS23650 (NIZ24_23630) 4472..4705 + 234 WP_238896426.1 hypothetical protein -
NIZ24_RS23655 (NIZ24_23635) 4702..5379 + 678 WP_256878449.1 hypothetical protein -
NIZ24_RS23660 (NIZ24_23640) 5435..5873 - 439 Protein_6 type II toxin-antitoxin system HicB family antitoxin -
NIZ24_RS23665 (NIZ24_23645) 5898..6078 - 181 Protein_7 type II toxin-antitoxin system HicA family toxin -
NIZ24_RS23670 (NIZ24_23650) 6557..6838 - 282 WP_256878450.1 hypothetical protein -
NIZ24_RS23675 (NIZ24_23655) 6853..7183 - 331 Protein_9 hypothetical protein -
NIZ24_RS23680 (NIZ24_23660) 7625..7867 - 243 WP_001450803.1 hypothetical protein Antitoxin
NIZ24_RS23685 (NIZ24_23665) 7857..8123 - 267 WP_000702249.1 hypothetical protein Toxin
NIZ24_RS23690 (NIZ24_23670) 8174..8398 - 225 WP_000749828.1 hypothetical protein -
NIZ24_RS23695 (NIZ24_23675) 8494..8718 - 225 WP_000866040.1 hypothetical protein -
NIZ24_RS23700 (NIZ24_23680) 8758..9081 - 324 WP_000432877.1 hypothetical protein -
NIZ24_RS23705 (NIZ24_23685) 10783..11787 + 1005 WP_001208090.1 replication initiation protein -
NIZ24_RS23710 (NIZ24_23690) 12161..12499 - 339 WP_000612441.1 helix-turn-helix transcriptional regulator -
NIZ24_RS23715 (NIZ24_23695) 12698..12985 + 288 WP_000332248.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..37918 37918


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10242.76 Da        Isoelectric Point: 9.9280

>T249586 WP_000702249.1 NZ_CP099873:c8123-7857 [Escherichia albertii]
MKIRKGDRQYYLNKEGNMFHLVKRVKTFSKSATLGKTKATVITVADLIFHEDAFDTIDFTRGGLRENDKEVVSMMIQEMN
NEREKNVN

Download         Length: 267 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9288.69 Da        Isoelectric Point: 9.7120

>AT249586 WP_001450803.1 NZ_CP099873:c7867-7625 [Escherichia albertii]
MLTENTPENIKRLRQKIGLTQRECAEIFSMNPRTWRRKEEPAGTASGTALTPVEFKYLQLLAGEHPEYVLRKRDKPKCSE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K6A0X9

Antitoxin

Source ID Structure
AlphaFold DB A0A3H7VMJ5

References