Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 131039..131564 Replicon plasmid plas1
Accession NZ_CP099872
Organism Escherichia albertii strain 253_2_EW_B

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NIZ24_RS23540 Protein ID WP_001159871.1
Coordinates 131039..131344 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag NIZ24_RS23545 Protein ID WP_000813639.1
Coordinates 131346..131564 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ24_RS23505 (126696) 126696..126902 - 207 Protein_145 transposase -
NIZ24_RS23510 (126999) 126999..127208 + 210 Protein_146 DUF4113 domain-containing protein -
NIZ24_RS23515 (127210) 127210..127626 - 417 WP_089553857.1 plasmid partitioning/stability family protein -
NIZ24_RS23520 (127619) 127619..128599 - 981 WP_256878413.1 plasmid segregation protein ParM -
NIZ24_RS23525 (129011) 129011..129319 - 309 WP_000030204.1 molecular chaperone GroEL -
NIZ24_RS23530 (129406) 129406..130050 - 645 WP_001144036.1 ParA family protein -
NIZ24_RS23535 (130230) 130230..131038 - 809 Protein_151 site-specific integrase -
NIZ24_RS23540 (131039) 131039..131344 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NIZ24_RS23545 (131346) 131346..131564 - 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIZ24_RS23550 (132037) 132037..133018 - 982 Protein_154 IS3 family transposase -
NIZ24_RS23555 (133250) 133250..134785 + 1536 WP_256878094.1 IS21-like element ISSso4 family transposase -
NIZ24_RS23560 (134802) 134802..135557 + 756 WP_001282649.1 IS21-like element ISSso4 family helper ATPase IstB -
NIZ24_RS23565 (135660) 135660..135809 - 150 Protein_157 IS3 family transposase -
NIZ24_RS23570 (136039) 136039..136212 + 174 Protein_158 transposase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - iucA / iucB / iucC / iucD / iutA / gspG / gspH / gspL / vat / espL2 / espL2 / espL2 1..145531 145531


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T249585 WP_001159871.1 NZ_CP099872:c131344-131039 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT249585 WP_000813639.1 NZ_CP099872:c131564-131346 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References