Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 885421..886072 | Replicon | chromosome |
| Accession | NZ_CP099871 | ||
| Organism | Escherichia albertii strain 253_2_EW_B | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B1EG01 |
| Locus tag | NIZ24_RS04285 | Protein ID | WP_000244763.1 |
| Coordinates | 885668..886072 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NIZ24_RS04280 | Protein ID | WP_000354046.1 |
| Coordinates | 885421..885687 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ24_RS04255 (881132) | 881132..882565 | - | 1434 | WP_059235410.1 | 6-phospho-beta-glucosidase BglA | - |
| NIZ24_RS04260 (882610) | 882610..882921 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| NIZ24_RS04265 (883089) | 883089..883748 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
| NIZ24_RS04270 (884189) | 884189..885169 | - | 981 | WP_059235393.1 | tRNA-modifying protein YgfZ | - |
| NIZ24_RS04275 (885201) | 885201..885431 | + | 231 | WP_000181267.1 | hypothetical protein | - |
| NIZ24_RS04280 (885421) | 885421..885687 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NIZ24_RS04285 (885668) | 885668..886072 | + | 405 | WP_000244763.1 | protein YgfX | Toxin |
| NIZ24_RS04290 (886111) | 886111..886632 | - | 522 | WP_059235395.1 | flavodoxin FldB | - |
| NIZ24_RS04295 (886744) | 886744..887640 | + | 897 | WP_059228147.1 | site-specific tyrosine recombinase XerD | - |
| NIZ24_RS04300 (887665) | 887665..888375 | + | 711 | WP_256878190.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NIZ24_RS04305 (888381) | 888381..890114 | + | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T249569 WP_000244763.1 NZ_CP099871:885668-886072 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6P9B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |