Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3536293..3536911 | Replicon | chromosome |
| Accession | NZ_CP099868 | ||
| Organism | Escherichia albertii strain 254_1_EW_B | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NIZ25_RS17280 | Protein ID | WP_001280991.1 |
| Coordinates | 3536693..3536911 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | NIZ25_RS17275 | Protein ID | WP_000344798.1 |
| Coordinates | 3536293..3536667 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ25_RS17265 (3531373) | 3531373..3532566 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NIZ25_RS17270 (3532589) | 3532589..3535738 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| NIZ25_RS17275 (3536293) | 3536293..3536667 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| NIZ25_RS17280 (3536693) | 3536693..3536911 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NIZ25_RS17285 (3537088) | 3537088..3537645 | + | 558 | WP_000093561.1 | maltose O-acetyltransferase | - |
| NIZ25_RS17290 (3537753) | 3537753..3538223 | + | 471 | WP_059224581.1 | YlaC family protein | - |
| NIZ25_RS17295 (3538387) | 3538387..3539937 | + | 1551 | WP_256876043.1 | EAL domain-containing protein | - |
| NIZ25_RS17300 (3539975) | 3539975..3540328 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| NIZ25_RS17310 (3540709) | 3540709..3541020 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| NIZ25_RS17315 (3541050) | 3541050..3541622 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249551 WP_001280991.1 NZ_CP099868:3536693-3536911 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT249551 WP_000344798.1 NZ_CP099868:3536293-3536667 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|