Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 889958..890609 | Replicon | chromosome |
| Accession | NZ_CP099868 | ||
| Organism | Escherichia albertii strain 254_1_EW_B | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B1EG01 |
| Locus tag | NIZ25_RS04290 | Protein ID | WP_000244763.1 |
| Coordinates | 890205..890609 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | NIZ25_RS04285 | Protein ID | WP_059224144.1 |
| Coordinates | 889958..890224 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ25_RS04260 (885658) | 885658..887091 | - | 1434 | WP_024164724.1 | 6-phospho-beta-glucosidase BglA | - |
| NIZ25_RS04265 (887136) | 887136..887447 | + | 312 | WP_098401332.1 | N(4)-acetylcytidine aminohydrolase | - |
| NIZ25_RS04270 (887615) | 887615..888274 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
| NIZ25_RS04275 (888726) | 888726..889706 | - | 981 | WP_059224140.1 | tRNA-modifying protein YgfZ | - |
| NIZ25_RS04280 (889738) | 889738..889968 | + | 231 | WP_059224142.1 | hypothetical protein | - |
| NIZ25_RS04285 (889958) | 889958..890224 | + | 267 | WP_059224144.1 | FAD assembly factor SdhE | Antitoxin |
| NIZ25_RS04290 (890205) | 890205..890609 | + | 405 | WP_000244763.1 | protein YgfX | Toxin |
| NIZ25_RS04295 (890643) | 890643..891164 | - | 522 | WP_059221135.1 | flavodoxin FldB | - |
| NIZ25_RS04300 (891276) | 891276..892172 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NIZ25_RS04305 (892197) | 892197..892907 | + | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NIZ25_RS04310 (892913) | 892913..894646 | + | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T249539 WP_000244763.1 NZ_CP099868:890205-890609 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|