Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 457467..458120 | Replicon | chromosome |
| Accession | NZ_CP099856 | ||
| Organism | Acinetobacter baumannii strain 17978S | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1E3M967 |
| Locus tag | NIY04_RS02245 | Protein ID | WP_009518132.1 |
| Coordinates | 457731..458120 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | NIY04_RS02240 | Protein ID | WP_001288210.1 |
| Coordinates | 457467..457724 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY04_RS02220 (NIY04_02220) | 452982..453989 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| NIY04_RS02225 (NIY04_02225) | 454008..454385 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| NIY04_RS02230 (NIY04_02230) | 454567..456057 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NIY04_RS02235 (NIY04_02235) | 456107..457279 | - | 1173 | WP_001190550.1 | acyl-CoA dehydrogenase family protein | - |
| NIY04_RS02240 (NIY04_02240) | 457467..457724 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| NIY04_RS02245 (NIY04_02245) | 457731..458120 | + | 390 | WP_009518132.1 | hypothetical protein | Toxin |
| NIY04_RS02250 (NIY04_02250) | 458890..459975 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| NIY04_RS02255 (NIY04_02255) | 460054..460620 | + | 567 | WP_000651535.1 | rhombosortase | - |
| NIY04_RS02260 (NIY04_02260) | 460808..463003 | + | 2196 | WP_001158904.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15720.03 Da Isoelectric Point: 10.4623
>T249532 WP_009518132.1 NZ_CP099856:457731-458120 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFINFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKKLTSIIWFDQMSLTEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFINFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKKLTSIIWFDQMSLTEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1E3M967 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BQM7 |