Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 5484152..5484812 | Replicon | chromosome |
Accession | NZ_CP099837 | ||
Organism | Nocardiopsis exhalans strain JCM11759T |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NE857_RS24215 | Protein ID | WP_254417792.1 |
Coordinates | 5484408..5484812 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NE857_RS24210 | Protein ID | WP_254417791.1 |
Coordinates | 5484152..5484415 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE857_RS24200 (NE857_24200) | 5480785..5482863 | + | 2079 | WP_254422080.1 | biotin carboxylase N-terminal domain-containing protein | - |
NE857_RS24205 (NE857_24205) | 5482860..5484017 | + | 1158 | WP_254417790.1 | acyl-CoA dehydrogenase family protein | - |
NE857_RS24210 (NE857_24210) | 5484152..5484415 | + | 264 | WP_254417791.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NE857_RS24215 (NE857_24215) | 5484408..5484812 | + | 405 | WP_254417792.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NE857_RS24220 (NE857_24220) | 5485106..5486050 | + | 945 | WP_254417793.1 | serine/threonine-protein kinase | - |
NE857_RS24225 (NE857_24225) | 5486406..5487095 | + | 690 | WP_254417794.1 | hypothetical protein | - |
NE857_RS24230 (NE857_24230) | 5487251..5487409 | + | 159 | WP_184365480.1 | hypothetical protein | - |
NE857_RS24235 (NE857_24235) | 5487506..5489482 | - | 1977 | WP_017581535.1 | threonine--tRNA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14297.56 Da Isoelectric Point: 4.8889
>T249528 WP_254417792.1 NZ_CP099837:5484408-5484812 [Nocardiopsis exhalans]
MPESHASGVLATCAFIDLPVLDPAVLPDFPEITSVTMAELHQGIAMAKEPVARAARTERLQAAAVDFVPLPFDGEAAARY
GTLVALTIAENRSPKPRRMDLMIASIASVHALPLHTRNAEDFKGLESALEVIAI
MPESHASGVLATCAFIDLPVLDPAVLPDFPEITSVTMAELHQGIAMAKEPVARAARTERLQAAAVDFVPLPFDGEAAARY
GTLVALTIAENRSPKPRRMDLMIASIASVHALPLHTRNAEDFKGLESALEVIAI
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|