Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Fic(toxin)
Location 1874772..1875380 Replicon chromosome
Accession NZ_CP099837
Organism Nocardiopsis exhalans strain JCM11759T

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag NE857_RS08385 Protein ID WP_254420459.1
Coordinates 1874976..1875380 (+) Length 135 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag NE857_RS08380 Protein ID WP_184370619.1
Coordinates 1874772..1874975 (+) Length 68 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE857_RS08340 (NE857_08340) 1870244..1870564 + 321 WP_017584138.1 hypothetical protein -
NE857_RS08345 (NE857_08345) 1870608..1870781 + 174 WP_017546417.1 hypothetical protein -
NE857_RS08350 (NE857_08350) 1870835..1871164 + 330 WP_254420454.1 hypothetical protein -
NE857_RS08355 (NE857_08355) 1871166..1871771 + 606 WP_017584136.1 DUF6286 domain-containing protein -
NE857_RS08360 (NE857_08360) 1871774..1872364 + 591 WP_254420455.1 alkaline shock response membrane anchor protein AmaP -
NE857_RS08365 (NE857_08365) 1872422..1873669 - 1248 WP_254420456.1 hypothetical protein -
NE857_RS08370 (NE857_08370) 1873983..1874234 + 252 WP_254420457.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
NE857_RS08375 (NE857_08375) 1874227..1874487 + 261 WP_254420458.1 type II toxin-antitoxin system RelE/ParE family toxin -
NE857_RS08380 (NE857_08380) 1874772..1874975 + 204 WP_184370619.1 hypothetical protein Antitoxin
NE857_RS08385 (NE857_08385) 1874976..1875380 + 405 WP_254420459.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NE857_RS08390 (NE857_08390) 1875394..1876806 - 1413 WP_254420460.1 L-serine ammonia-lyase -
NE857_RS08395 (NE857_08395) 1876891..1878159 - 1269 WP_254420461.1 serine hydroxymethyltransferase -
NE857_RS08400 (NE857_08400) 1878161..1878541 - 381 WP_254420462.1 glycine cleavage system protein GcvH -
NE857_RS08405 (NE857_08405) 1878703..1879818 - 1116 WP_254420463.1 glycine cleavage system aminomethyltransferase GcvT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(4-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14706.55 Da        Isoelectric Point: 4.4161

>T249527 WP_254420459.1 NZ_CP099837:1874976-1875380 [Nocardiopsis exhalans]
VDDVFYLDSAMVIEITTMALAQEGQGPAMVRETGLLESAVHRPMGSSFGDEHYPDIFEKAAALMHSLARNHVFFDGNKRA
AWNSAATFLEVNGWSLAEPVDVDRAEHFVLYVAEGKLGDIEDIAAALRAFHVLN

Download         Length: 405 bp

Antitoxin


Download         Length: 68 a.a.        Molecular weight: 7604.56 Da        Isoelectric Point: 5.1388

>AT249527 WP_184370619.1 NZ_CP099837:1874772-1874975 [Nocardiopsis exhalans]
MSALGIEFTEAESEQIRQTAAAEQRSPQELVQEMRESVLADVRRRRFEAAAKRVTTLSAELNERLAK

Download         Length: 204 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References