Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/PHD-RelE
Location 1873983..1874487 Replicon chromosome
Accession NZ_CP099837
Organism Nocardiopsis exhalans strain JCM11759T

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NE857_RS08375 Protein ID WP_254420458.1
Coordinates 1874227..1874487 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NE857_RS08370 Protein ID WP_254420457.1
Coordinates 1873983..1874234 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE857_RS08330 (NE857_08330) 1869486..1869710 + 225 WP_254420452.1 CsbD family protein -
NE857_RS08335 (NE857_08335) 1869762..1870241 + 480 WP_254420453.1 Asp23/Gls24 family envelope stress response protein -
NE857_RS08340 (NE857_08340) 1870244..1870564 + 321 WP_017584138.1 hypothetical protein -
NE857_RS08345 (NE857_08345) 1870608..1870781 + 174 WP_017546417.1 hypothetical protein -
NE857_RS08350 (NE857_08350) 1870835..1871164 + 330 WP_254420454.1 hypothetical protein -
NE857_RS08355 (NE857_08355) 1871166..1871771 + 606 WP_017584136.1 DUF6286 domain-containing protein -
NE857_RS08360 (NE857_08360) 1871774..1872364 + 591 WP_254420455.1 alkaline shock response membrane anchor protein AmaP -
NE857_RS08365 (NE857_08365) 1872422..1873669 - 1248 WP_254420456.1 hypothetical protein -
NE857_RS08370 (NE857_08370) 1873983..1874234 + 252 WP_254420457.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NE857_RS08375 (NE857_08375) 1874227..1874487 + 261 WP_254420458.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NE857_RS08380 (NE857_08380) 1874772..1874975 + 204 WP_184370619.1 hypothetical protein -
NE857_RS08385 (NE857_08385) 1874976..1875380 + 405 WP_254420459.1 type II toxin-antitoxin system death-on-curing family toxin -
NE857_RS08390 (NE857_08390) 1875394..1876806 - 1413 WP_254420460.1 L-serine ammonia-lyase -
NE857_RS08395 (NE857_08395) 1876891..1878159 - 1269 WP_254420461.1 serine hydroxymethyltransferase -
NE857_RS08400 (NE857_08400) 1878161..1878541 - 381 WP_254420462.1 glycine cleavage system protein GcvH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(14-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-61)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9753.35 Da        Isoelectric Point: 9.7871

>T249526 WP_254420458.1 NZ_CP099837:1874227-1874487 [Nocardiopsis exhalans]
MSKYTTVFKVEAQLELRKVPRDYAMAILRKLAELETDPFAFGTTALVGVPGHRRLRVGDYRVVYTVDNGQLIIVVVQVGH
RSTIYD

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9324.45 Da        Isoelectric Point: 4.9062

>AT249526 WP_254420457.1 NZ_CP099837:1873983-1874234 [Nocardiopsis exhalans]
MTQTLSSREFRAHLSEAIDRAKSGDATVVTRNGRAVGAFVPMEVLEQARAREEEELRRLVEERRNSPTVPIADVMAETLA
RDE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References