Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1461319..1461974 | Replicon | chromosome |
| Accession | NZ_CP099837 | ||
| Organism | Nocardiopsis exhalans strain JCM11759T | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NE857_RS06605 | Protein ID | WP_254420205.1 |
| Coordinates | 1461549..1461974 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NE857_RS06600 | Protein ID | WP_017580610.1 |
| Coordinates | 1461319..1461552 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NE857_RS06575 (NE857_06575) | 1456390..1456977 | - | 588 | WP_254421895.1 | hypothetical protein | - |
| NE857_RS06580 (NE857_06580) | 1457170..1458618 | - | 1449 | WP_254420201.1 | DNA recombination protein RmuC | - |
| NE857_RS06585 (NE857_06585) | 1458698..1458976 | + | 279 | WP_254420202.1 | hypothetical protein | - |
| NE857_RS06590 (NE857_06590) | 1458980..1459945 | - | 966 | WP_254420203.1 | FkbM family methyltransferase | - |
| NE857_RS06595 (NE857_06595) | 1460114..1461199 | + | 1086 | WP_254420204.1 | redox-regulated ATPase YchF | - |
| NE857_RS06600 (NE857_06600) | 1461319..1461552 | + | 234 | WP_017580610.1 | Arc family DNA-binding protein | Antitoxin |
| NE857_RS06605 (NE857_06605) | 1461549..1461974 | + | 426 | WP_254420205.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NE857_RS06610 (NE857_06610) | 1461971..1462171 | + | 201 | WP_254420206.1 | GNAT family N-acetyltransferase | - |
| NE857_RS06615 (NE857_06615) | 1462875..1463840 | + | 966 | WP_254420207.1 | conjugal transfer protein | - |
| NE857_RS06620 (NE857_06620) | 1463924..1464247 | + | 324 | WP_017580620.1 | hypothetical protein | - |
| NE857_RS06625 (NE857_06625) | 1464267..1464521 | + | 255 | Protein_1291 | conjugal transfer protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15155.15 Da Isoelectric Point: 4.4242
>T249525 WP_254420205.1 NZ_CP099837:1461549-1461974 [Nocardiopsis exhalans]
VIVLDTNVISEIFRPAPEPRVLEWLTSLTDDVAITSITLAELLAGVRRLPDGRRKDVLATRIDEAIEPYRGSRSVLAFDD
IAAERYADVLASRESAGAPISTADAQIAAICLAHDATCATRNVKDFAHTGVEIIDPWAGAS
VIVLDTNVISEIFRPAPEPRVLEWLTSLTDDVAITSITLAELLAGVRRLPDGRRKDVLATRIDEAIEPYRGSRSVLAFDD
IAAERYADVLASRESAGAPISTADAQIAAICLAHDATCATRNVKDFAHTGVEIIDPWAGAS
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|