Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 60805..61330 Replicon plasmid unnamed2
Accession NZ_CP099836
Organism Klebsiella quasipneumoniae strain Y7-3

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NDO72_RS26650 Protein ID WP_013023785.1
Coordinates 61025..61330 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NDO72_RS26645 Protein ID WP_001568025.1
Coordinates 60805..61023 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDO72_RS26625 (NDO72_26625) 55961..56740 + 780 WP_013023780.1 hypothetical protein -
NDO72_RS26630 (NDO72_26630) 57016..58539 + 1524 WP_017899887.1 hypothetical protein -
NDO72_RS26635 (NDO72_26635) 58573..59700 + 1128 WP_013023782.1 DUF4238 domain-containing protein -
NDO72_RS26640 (NDO72_26640) 59697..59987 + 291 WP_013023783.1 hypothetical protein -
NDO72_RS26645 (NDO72_26645) 60805..61023 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NDO72_RS26650 (NDO72_26650) 61025..61330 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NDO72_RS26655 (NDO72_26655) 61499..61894 + 396 WP_017899885.1 hypothetical protein -
NDO72_RS26660 (NDO72_26660) 61921..62235 + 315 WP_053389906.1 hypothetical protein -
NDO72_RS26665 (NDO72_26665) 62246..63262 + 1017 WP_017899884.1 hypothetical protein -
NDO72_RS26670 (NDO72_26670) 63460..64254 + 795 WP_004197635.1 site-specific integrase -
NDO72_RS26675 (NDO72_26675) 64726..65028 - 303 WP_004197636.1 hypothetical protein -
NDO72_RS26680 (NDO72_26680) 65025..65651 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrS1 / blaCTX-M-3 / blaTEM-1B / floR / tet(A) / mph(A) / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr - 1..123534 123534


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T249523 WP_013023785.1 NZ_CP099836:61025-61330 [Klebsiella quasipneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT249523 WP_001568025.1 NZ_CP099836:60805-61023 [Klebsiella quasipneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References