Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 147469..148205 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP099835 | ||
| Organism | Klebsiella quasipneumoniae strain Y7-3 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | NDO72_RS26150 | Protein ID | WP_003026803.1 |
| Coordinates | 147469..147951 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NDO72_RS26155 | Protein ID | WP_003026799.1 |
| Coordinates | 147939..148205 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDO72_RS26130 (NDO72_26130) | 142568..143733 | + | 1166 | Protein_143 | IS3 family transposase | - |
| NDO72_RS26135 (NDO72_26135) | 143937..144935 | + | 999 | WP_001610306.1 | hypothetical protein | - |
| NDO72_RS26140 (NDO72_26140) | 144939..145856 | + | 918 | WP_158003452.1 | S-4TM family putative pore-forming effector | - |
| NDO72_RS26145 (NDO72_26145) | 145887..147290 | - | 1404 | WP_253231046.1 | ISNCY family transposase | - |
| NDO72_RS26150 (NDO72_26150) | 147469..147951 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| NDO72_RS26155 (NDO72_26155) | 147939..148205 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NDO72_RS26160 (NDO72_26160) | 148381..148635 | - | 255 | WP_004152108.1 | hypothetical protein | - |
| NDO72_RS26165 (NDO72_26165) | 148711..148968 | - | 258 | WP_004152107.1 | hypothetical protein | - |
| NDO72_RS26170 (NDO72_26170) | 149017..149220 | - | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| NDO72_RS26175 (NDO72_26175) | 149254..149622 | - | 369 | WP_004152105.1 | hypothetical protein | - |
| NDO72_RS26180 (NDO72_26180) | 149666..150160 | - | 495 | WP_004152104.1 | DNA-binding protein | - |
| NDO72_RS26185 (NDO72_26185) | 150191..150766 | - | 576 | WP_004152103.1 | hypothetical protein | - |
| NDO72_RS26190 (NDO72_26190) | 150754..151023 | - | 270 | WP_004152102.1 | hypothetical protein | - |
| NDO72_RS26195 (NDO72_26195) | 151381..151731 | + | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| NDO72_RS26200 (NDO72_26200) | 151781..152143 | + | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..170537 | 170537 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T249522 WP_003026803.1 NZ_CP099835:c147951-147469 [Klebsiella quasipneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |