Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4757031..4757547 | Replicon | chromosome |
| Accession | NZ_CP099834 | ||
| Organism | Klebsiella quasipneumoniae strain Y7-3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NDO72_RS22805 | Protein ID | WP_080820655.1 |
| Coordinates | 4757031..4757315 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1C1EW86 |
| Locus tag | NDO72_RS22810 | Protein ID | WP_023291757.1 |
| Coordinates | 4757305..4757547 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDO72_RS22795 (4754029) | 4754029..4756167 | + | 2139 | WP_080820653.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NDO72_RS22800 (4756563) | 4756563..4757027 | + | 465 | WP_012969085.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NDO72_RS22805 (4757031) | 4757031..4757315 | - | 285 | WP_080820655.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NDO72_RS22810 (4757305) | 4757305..4757547 | - | 243 | WP_023291757.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NDO72_RS22815 (4757625) | 4757625..4759535 | - | 1911 | WP_044525201.1 | PRD domain-containing protein | - |
| NDO72_RS22820 (4759558) | 4759558..4760709 | - | 1152 | WP_101995763.1 | lactonase family protein | - |
| NDO72_RS22825 (4760776) | 4760776..4761516 | - | 741 | WP_004206507.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10957.79 Da Isoelectric Point: 10.3796
>T249521 WP_080820655.1 NZ_CP099834:c4757315-4757031 [Klebsiella quasipneumoniae]
MTYELAFDPRAWREWQKLGETIKKQFKNKLQQVVENPRIASASLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKLGETIKKQFKNKLQQVVENPRIASASLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|