Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4044588..4045207 Replicon chromosome
Accession NZ_CP099834
Organism Klebsiella quasipneumoniae strain Y7-3

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NDO72_RS19475 Protein ID WP_002892050.1
Coordinates 4044989..4045207 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NDO72_RS19470 Protein ID WP_002892066.1
Coordinates 4044588..4044962 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDO72_RS19460 (4039745) 4039745..4040938 + 1194 WP_253230762.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NDO72_RS19465 (4040961) 4040961..4044107 + 3147 WP_023288644.1 multidrug efflux RND transporter permease subunit AcrB -
NDO72_RS19470 (4044588) 4044588..4044962 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NDO72_RS19475 (4044989) 4044989..4045207 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NDO72_RS19480 (4045366) 4045366..4045932 + 567 WP_023288643.1 maltose O-acetyltransferase -
NDO72_RS19485 (4045904) 4045904..4046035 - 132 WP_162543094.1 hypothetical protein -
NDO72_RS19490 (4046069) 4046069..4046539 + 471 WP_064155186.1 YlaC family protein -
NDO72_RS19495 (4046508) 4046508..4047965 - 1458 WP_064155187.1 PLP-dependent aminotransferase family protein -
NDO72_RS19500 (4048066) 4048066..4048764 + 699 WP_044521289.1 GNAT family protein -
NDO72_RS19505 (4048761) 4048761..4048901 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NDO72_RS19510 (4048901) 4048901..4049164 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T249519 WP_002892050.1 NZ_CP099834:4044989-4045207 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT249519 WP_002892066.1 NZ_CP099834:4044588-4044962 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References