Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 786478..787135 | Replicon | chromosome |
Accession | NZ_CP099834 | ||
Organism | Klebsiella quasipneumoniae strain Y7-3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2N4VX63 |
Locus tag | NDO72_RS03905 | Protein ID | WP_023290968.1 |
Coordinates | 786725..787135 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NDO72_RS03900 | Protein ID | WP_002916312.1 |
Coordinates | 786478..786744 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDO72_RS03875 (781628) | 781628..783061 | - | 1434 | WP_023290972.1 | 6-phospho-beta-glucosidase BglA | - |
NDO72_RS03880 (783180) | 783180..783908 | - | 729 | WP_032454033.1 | MurR/RpiR family transcriptional regulator | - |
NDO72_RS03885 (783959) | 783959..784270 | + | 312 | WP_023290970.1 | N(4)-acetylcytidine aminohydrolase | - |
NDO72_RS03890 (784434) | 784434..785093 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
NDO72_RS03895 (785249) | 785249..786232 | - | 984 | WP_060590308.1 | tRNA-modifying protein YgfZ | - |
NDO72_RS03900 (786478) | 786478..786744 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NDO72_RS03905 (786725) | 786725..787135 | + | 411 | WP_023290968.1 | protein YgfX | Toxin |
NDO72_RS03910 (787143) | 787143..787664 | - | 522 | WP_004205324.1 | flavodoxin FldB | - |
NDO72_RS03915 (787765) | 787765..788661 | + | 897 | WP_044524682.1 | site-specific tyrosine recombinase XerD | - |
NDO72_RS03920 (788684) | 788684..789397 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NDO72_RS03925 (789403) | 789403..791136 | + | 1734 | WP_253230893.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16075.89 Da Isoelectric Point: 11.4778
>T249512 WP_023290968.1 NZ_CP099834:786725-787135 [Klebsiella quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDPGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDPGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N4VX63 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |