Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 1968941..1969859 | Replicon | chromosome |
| Accession | NZ_CP099815 | ||
| Organism | Yersinia ruckeri strain NVI-11050 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | LNQ40_RS09050 | Protein ID | WP_038242633.1 |
| Coordinates | 1969401..1969859 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A085U7R3 |
| Locus tag | LNQ40_RS09045 | Protein ID | WP_038242631.1 |
| Coordinates | 1968941..1969387 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LNQ40_RS09025 (LNQ40_009015) | 1964639..1965343 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
| LNQ40_RS09030 (LNQ40_009020) | 1965354..1966328 | - | 975 | WP_071666721.1 | L-Ala-D/L-Glu epimerase | - |
| LNQ40_RS09035 (LNQ40_009025) | 1966478..1966981 | + | 504 | WP_004717547.1 | thiol peroxidase | - |
| LNQ40_RS09040 (LNQ40_009030) | 1967016..1968623 | - | 1608 | WP_038251390.1 | transcriptional regulator TyrR | - |
| LNQ40_RS09045 (LNQ40_009035) | 1968941..1969387 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
| LNQ40_RS09050 (LNQ40_009040) | 1969401..1969859 | + | 459 | WP_038242633.1 | RES domain-containing protein | Toxin |
| LNQ40_RS09055 (LNQ40_009045) | 1969863..1970921 | - | 1059 | WP_071666720.1 | YcjF family protein | - |
| LNQ40_RS09060 (LNQ40_009050) | 1970918..1972315 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
| LNQ40_RS09065 (LNQ40_009055) | 1972296..1972538 | - | 243 | WP_087931058.1 | phage shock protein PspD | - |
| LNQ40_RS09070 (LNQ40_009060) | 1972602..1972961 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
| LNQ40_RS09075 (LNQ40_009065) | 1972961..1973188 | - | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
| LNQ40_RS09080 (LNQ40_009070) | 1973272..1973937 | - | 666 | WP_004717561.1 | phage shock protein PspA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17072.55 Da Isoelectric Point: 6.6384
>T249506 WP_038242633.1 NZ_CP099815:1969401-1969859 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT249506 WP_038242631.1 NZ_CP099815:1968941-1969387 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|