Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 957967..958590 | Replicon | chromosome |
Accession | NZ_CP099815 | ||
Organism | Yersinia ruckeri strain NVI-11050 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A085U5C4 |
Locus tag | LNQ40_RS04335 | Protein ID | WP_038243726.1 |
Coordinates | 957967..958170 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A085U5C5 |
Locus tag | LNQ40_RS04340 | Protein ID | WP_004718732.1 |
Coordinates | 958222..958590 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNQ40_RS04310 (LNQ40_004305) | 953822..954160 | + | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
LNQ40_RS04315 (LNQ40_004310) | 954199..955488 | + | 1290 | WP_004718723.1 | ammonium transporter AmtB | - |
LNQ40_RS04320 (LNQ40_004315) | 955603..956466 | - | 864 | WP_004718726.1 | acyl-CoA thioesterase II | - |
LNQ40_RS04325 (LNQ40_004320) | 956844..957158 | - | 315 | WP_004718728.1 | MGMT family protein | - |
LNQ40_RS04335 (LNQ40_004330) | 957967..958170 | - | 204 | WP_038243726.1 | expression modulating protein YmoA | Toxin |
LNQ40_RS04340 (LNQ40_004335) | 958222..958590 | - | 369 | WP_004718732.1 | Hha toxicity modulator TomB | Antitoxin |
LNQ40_RS04345 (LNQ40_004340) | 959639..959800 | + | 162 | WP_004718735.1 | hypothetical protein | - |
LNQ40_RS04350 (LNQ40_004345) | 959919..960062 | - | 144 | WP_071666974.1 | type B 50S ribosomal protein L36 | - |
LNQ40_RS04355 (LNQ40_004350) | 960082..960336 | - | 255 | WP_038243728.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8037.27 Da Isoelectric Point: 6.4573
>T249505 WP_038243726.1 NZ_CP099815:c958170-957967 [Yersinia ruckeri]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.08 Da Isoelectric Point: 4.4225
>AT249505 WP_004718732.1 NZ_CP099815:c958590-958222 [Yersinia ruckeri]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C5 |