Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 463548..464082 Replicon chromosome
Accession NZ_CP099815
Organism Yersinia ruckeri strain NVI-11050

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LNQ40_RS02100 Protein ID WP_071666901.1
Coordinates 463792..464082 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A1JJ37
Locus tag LNQ40_RS02095 Protein ID WP_005175264.1
Coordinates 463548..463802 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LNQ40_RS02070 (LNQ40_002070) 459222..460370 - 1149 Protein_399 McrC family protein -
LNQ40_RS02075 (LNQ40_002075) 460436..461586 + 1151 WP_087931031.1 IS3 family transposase -
LNQ40_RS02080 (LNQ40_002080) 461630..462490 + 861 WP_245759121.1 toll/interleukin-1 receptor domain-containing protein -
LNQ40_RS02085 (LNQ40_002085) 462566..462874 + 309 WP_038245765.1 hypothetical protein -
LNQ40_RS02090 (LNQ40_002090) 462922..463374 + 453 Protein_403 site-specific integrase -
LNQ40_RS02095 (LNQ40_002095) 463548..463802 + 255 WP_005175264.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
LNQ40_RS02100 (LNQ40_002100) 463792..464082 + 291 WP_071666901.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LNQ40_RS02105 (LNQ40_002105) 464346..464735 + 390 WP_049689831.1 restriction endonuclease subunit S -
LNQ40_RS02110 (LNQ40_002110) 464859..465434 + 576 WP_038245760.1 DarT ssDNA thymidine ADP-ribosyltransferase family protein -
LNQ40_RS02115 (LNQ40_002115) 465437..466093 + 657 WP_038245758.1 DUF4433 domain-containing protein -
LNQ40_RS02120 (LNQ40_002120) 466090..467157 + 1068 WP_038245756.1 macro domain-containing protein -
LNQ40_RS02125 (LNQ40_002125) 467178..467444 + 267 Protein_410 hypothetical protein -
LNQ40_RS02130 (LNQ40_002130) 467463..467861 - 399 Protein_411 integrase core domain-containing protein -
LNQ40_RS02135 (LNQ40_002135) 467860..468156 + 297 Protein_412 integrase core domain-containing protein -
LNQ40_RS02140 (LNQ40_002140) 468185..468290 - 106 Protein_413 transposase -
LNQ40_RS02145 (LNQ40_002145) 468304..468432 - 129 Protein_414 helix-turn-helix domain-containing protein -
LNQ40_RS02150 (LNQ40_002150) 468582..468812 + 231 Protein_415 DUF4942 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 460436..468156 7720
- flank IS/Tn - - 467908..468156 248


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11421.37 Da        Isoelectric Point: 9.9816

>T249503 WP_071666901.1 NZ_CP099815:463792-464082 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVILIVAVG
KREDEKAYDLAKKRIQ

Download         Length: 291 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9680.07 Da        Isoelectric Point: 4.8283

>AT249503 WP_005175264.1 NZ_CP099815:463548-463802 [Yersinia ruckeri]
MSTIQIRVDDELKKSAYQAFEKLNLSPSDALRLFLRYVAENEKLPFSEVSVMVSNQDEDADILAVVRERLKNPAKRIRVN
IDDL

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A1JJ37

References