Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3131429..3131963 | Replicon | chromosome |
| Accession | NZ_CP099813 | ||
| Organism | Yersinia ruckeri strain NVI-492 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LNQ24_RS14050 | Protein ID | WP_248577711.1 |
| Coordinates | 3131429..3131719 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A1JJ37 |
| Locus tag | LNQ24_RS14055 | Protein ID | WP_005175264.1 |
| Coordinates | 3131709..3131963 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LNQ24_RS14000 (LNQ24_013995) | 3126679..3126909 | - | 231 | Protein_2711 | DUF4942 domain-containing protein | - |
| LNQ24_RS14005 (LNQ24_014000) | 3127059..3127187 | + | 129 | Protein_2712 | helix-turn-helix domain-containing protein | - |
| LNQ24_RS14010 (LNQ24_014005) | 3127201..3127306 | + | 106 | Protein_2713 | transposase | - |
| LNQ24_RS14015 (LNQ24_014010) | 3127335..3127631 | - | 297 | Protein_2714 | transposase | - |
| LNQ24_RS14020 (LNQ24_014015) | 3127630..3128028 | + | 399 | Protein_2715 | integrase core domain-containing protein | - |
| LNQ24_RS14025 (LNQ24_014020) | 3128047..3128333 | - | 287 | Protein_2716 | hypothetical protein | - |
| LNQ24_RS14030 (LNQ24_014025) | 3128354..3129421 | - | 1068 | WP_038275274.1 | macro domain-containing protein | - |
| LNQ24_RS14035 (LNQ24_014030) | 3129418..3130074 | - | 657 | WP_096823271.1 | DUF4433 domain-containing protein | - |
| LNQ24_RS14040 (LNQ24_014035) | 3130077..3130652 | - | 576 | WP_071706520.1 | DarT ssDNA thymidine ADP-ribosyltransferase family protein | - |
| LNQ24_RS14045 (LNQ24_014040) | 3130776..3131165 | - | 390 | WP_248577710.1 | restriction endonuclease subunit S | - |
| LNQ24_RS14050 (LNQ24_014045) | 3131429..3131719 | - | 291 | WP_248577711.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LNQ24_RS14055 (LNQ24_014050) | 3131709..3131963 | - | 255 | WP_005175264.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LNQ24_RS14060 (LNQ24_014055) | 3132137..3132349 | - | 213 | Protein_2723 | integrase | - |
| LNQ24_RS14065 (LNQ24_014060) | 3132381..3133531 | - | 1151 | Protein_2724 | IS3 family transposase | - |
| LNQ24_RS14070 (LNQ24_014065) | 3133558..3133851 | - | 294 | WP_248577580.1 | hypothetical protein | - |
| LNQ24_RS14075 (LNQ24_014070) | 3133837..3134805 | + | 969 | WP_248577581.1 | hypothetical protein | - |
| LNQ24_RS14080 (LNQ24_014075) | 3134834..3135018 | - | 185 | Protein_2727 | peptidase T | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3122815..3131963 | 9148 | |
| - | inside | IScluster/Tn | - | - | 3127335..3133531 | 6196 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11421.37 Da Isoelectric Point: 9.9816
>T249502 WP_248577711.1 NZ_CP099813:c3131719-3131429 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVILIVAVG
KREDEKAYDIAKKRIQ
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVILIVAVG
KREDEKAYDIAKKRIQ
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|