Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 3131429..3131963 Replicon chromosome
Accession NZ_CP099813
Organism Yersinia ruckeri strain NVI-492

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LNQ24_RS14050 Protein ID WP_248577711.1
Coordinates 3131429..3131719 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A1JJ37
Locus tag LNQ24_RS14055 Protein ID WP_005175264.1
Coordinates 3131709..3131963 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LNQ24_RS14000 (LNQ24_013995) 3126679..3126909 - 231 Protein_2711 DUF4942 domain-containing protein -
LNQ24_RS14005 (LNQ24_014000) 3127059..3127187 + 129 Protein_2712 helix-turn-helix domain-containing protein -
LNQ24_RS14010 (LNQ24_014005) 3127201..3127306 + 106 Protein_2713 transposase -
LNQ24_RS14015 (LNQ24_014010) 3127335..3127631 - 297 Protein_2714 transposase -
LNQ24_RS14020 (LNQ24_014015) 3127630..3128028 + 399 Protein_2715 integrase core domain-containing protein -
LNQ24_RS14025 (LNQ24_014020) 3128047..3128333 - 287 Protein_2716 hypothetical protein -
LNQ24_RS14030 (LNQ24_014025) 3128354..3129421 - 1068 WP_038275274.1 macro domain-containing protein -
LNQ24_RS14035 (LNQ24_014030) 3129418..3130074 - 657 WP_096823271.1 DUF4433 domain-containing protein -
LNQ24_RS14040 (LNQ24_014035) 3130077..3130652 - 576 WP_071706520.1 DarT ssDNA thymidine ADP-ribosyltransferase family protein -
LNQ24_RS14045 (LNQ24_014040) 3130776..3131165 - 390 WP_248577710.1 restriction endonuclease subunit S -
LNQ24_RS14050 (LNQ24_014045) 3131429..3131719 - 291 WP_248577711.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LNQ24_RS14055 (LNQ24_014050) 3131709..3131963 - 255 WP_005175264.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
LNQ24_RS14060 (LNQ24_014055) 3132137..3132349 - 213 Protein_2723 integrase -
LNQ24_RS14065 (LNQ24_014060) 3132381..3133531 - 1151 Protein_2724 IS3 family transposase -
LNQ24_RS14070 (LNQ24_014065) 3133558..3133851 - 294 WP_248577580.1 hypothetical protein -
LNQ24_RS14075 (LNQ24_014070) 3133837..3134805 + 969 WP_248577581.1 hypothetical protein -
LNQ24_RS14080 (LNQ24_014075) 3134834..3135018 - 185 Protein_2727 peptidase T -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3122815..3131963 9148
- inside IScluster/Tn - - 3127335..3133531 6196


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11421.37 Da        Isoelectric Point: 9.9816

>T249502 WP_248577711.1 NZ_CP099813:c3131719-3131429 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVILIVAVG
KREDEKAYDIAKKRIQ

Download         Length: 291 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9680.07 Da        Isoelectric Point: 4.8283

>AT249502 WP_005175264.1 NZ_CP099813:c3131963-3131709 [Yersinia ruckeri]
MSTIQIRVDDELKKSAYQAFEKLNLSPSDALRLFLRYVAENEKLPFSEVSVMVSNQDEDADILAVVRERLKNPAKRIRVN
IDDL

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A1JJ37

References