Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeV-yfjZ/CbtA-CbeA |
Location | 3152694..3153416 | Replicon | chromosome |
Accession | NZ_CP099811 | ||
Organism | Yersinia ruckeri strain NVI-9681 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | LNQ37_RS14705 | Protein ID | WP_234054819.1 |
Coordinates | 3152694..3153014 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | LNQ37_RS14710 | Protein ID | WP_234055013.1 |
Coordinates | 3153081..3153416 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNQ37_RS14690 (LNQ37_014680) | 3149489..3151330 | + | 1842 | WP_004723328.1 | RNA polymerase sigma factor RpoD | - |
LNQ37_RS14700 (LNQ37_014690) | 3151747..3152580 | - | 834 | WP_234054818.1 | DUF4942 domain-containing protein | - |
LNQ37_RS14705 (LNQ37_014695) | 3152694..3153014 | - | 321 | WP_234054819.1 | TA system toxin CbtA family protein | Toxin |
LNQ37_RS14710 (LNQ37_014700) | 3153081..3153416 | - | 336 | WP_234055013.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LNQ37_RS14715 (LNQ37_014705) | 3153430..3153909 | - | 480 | WP_234054820.1 | DNA repair protein RadC | - |
LNQ37_RS14720 (LNQ37_014710) | 3154610..3155428 | + | 819 | WP_234054821.1 | HNH endonuclease signature motif containing protein | - |
LNQ37_RS14725 (LNQ37_014715) | 3155494..3155934 | + | 441 | WP_234054822.1 | hypothetical protein | - |
LNQ37_RS14730 (LNQ37_014720) | 3156129..3157279 | + | 1151 | WP_248578295.1 | IS3 family transposase | - |
LNQ37_RS14735 (LNQ37_014725) | 3157297..3157731 | - | 435 | Protein_2857 | Arm DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12071.61 Da Isoelectric Point: 5.0486
>T249492 WP_234054819.1 NZ_CP099811:c3153014-3152694 [Yersinia ruckeri]
MQTTTVPATLPVSSRQSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDASIEEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQEQTPFLTATDILRAKRATGLMNT
MQTTTVPATLPVSSRQSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDASIEEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQEQTPFLTATDILRAKRATGLMNT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|