Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3002608..3003277 | Replicon | chromosome |
Accession | NZ_CP099811 | ||
Organism | Yersinia ruckeri strain NVI-9681 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A380QS17 |
Locus tag | LNQ37_RS14025 | Protein ID | WP_038241020.1 |
Coordinates | 3002608..3003030 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | LNQ37_RS14030 | Protein ID | WP_004719196.1 |
Coordinates | 3003011..3003277 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNQ37_RS14005 (LNQ37_013995) | 2998447..3000180 | - | 1734 | WP_038276198.1 | single-stranded-DNA-specific exonuclease RecJ | - |
LNQ37_RS14010 (LNQ37_014000) | 3000187..3000903 | - | 717 | WP_004719192.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LNQ37_RS14015 (LNQ37_014005) | 3000935..3001834 | - | 900 | WP_004719193.1 | site-specific tyrosine recombinase XerD | - |
LNQ37_RS14020 (LNQ37_014010) | 3001942..3002460 | + | 519 | WP_038241022.1 | flavodoxin FldB | - |
LNQ37_RS14025 (LNQ37_014015) | 3002608..3003030 | - | 423 | WP_038241020.1 | protein YgfX | Toxin |
LNQ37_RS14030 (LNQ37_014020) | 3003011..3003277 | - | 267 | WP_004719196.1 | FAD assembly factor SdhE | Antitoxin |
LNQ37_RS14035 (LNQ37_014025) | 3003571..3004563 | + | 993 | WP_038241018.1 | tRNA-modifying protein YgfZ | - |
LNQ37_RS14040 (LNQ37_014030) | 3004702..3005367 | - | 666 | WP_175537887.1 | hemolysin III family protein | - |
LNQ37_RS14045 (LNQ37_014035) | 3005684..3005940 | + | 257 | Protein_2722 | HD domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16451.41 Da Isoelectric Point: 11.1478
>T249491 WP_038241020.1 NZ_CP099811:c3003030-3002608 [Yersinia ruckeri]
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|