Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 2811507..2812135 Replicon chromosome
Accession NZ_CP099811
Organism Yersinia ruckeri strain NVI-9681

Toxin (Protein)


Gene name ypjF Uniprot ID -
Locus tag LNQ37_RS13170 Protein ID WP_248578455.1
Coordinates 2811848..2812135 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag LNQ37_RS13165 Protein ID WP_248578456.1
Coordinates 2811507..2811827 (+) Length 107 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LNQ37_RS13125 (LNQ37_013115) 2807059..2807892 + 834 WP_248578463.1 DUF932 domain-containing protein -
LNQ37_RS13130 (LNQ37_013120) 2808094..2808798 + 705 WP_248578462.1 WYL domain-containing protein -
LNQ37_RS13135 (LNQ37_013125) 2808795..2809409 + 615 WP_248578461.1 hypothetical protein -
LNQ37_RS13140 (LNQ37_013130) 2809499..2809909 + 411 WP_145580353.1 hypothetical protein -
LNQ37_RS13145 (LNQ37_013135) 2809987..2810223 + 237 WP_248578460.1 DUF905 domain-containing protein -
LNQ37_RS13150 (LNQ37_013140) 2810309..2810767 + 459 WP_248578459.1 antirestriction protein -
LNQ37_RS13155 (LNQ37_013145) 2810776..2811258 + 483 WP_248578458.1 DNA repair protein RadC -
LNQ37_RS13160 (LNQ37_013150) 2811267..2811488 + 222 WP_248578457.1 DUF987 domain-containing protein -
LNQ37_RS13165 (LNQ37_013155) 2811507..2811827 + 321 WP_248578456.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LNQ37_RS13170 (LNQ37_013160) 2811848..2812135 + 288 WP_248578455.1 TA system toxin CbtA family protein Toxin
LNQ37_RS13175 (LNQ37_013165) 2812583..2812822 + 240 Protein_2556 integrase arm-type DNA-binding domain-containing protein -
LNQ37_RS13180 (LNQ37_013170) 2812871..2813239 - 369 Protein_2557 integrase core domain-containing protein -
LNQ37_RS13185 (LNQ37_013175) 2813238..2813534 + 297 Protein_2558 integrase core domain-containing protein -
LNQ37_RS13190 (LNQ37_013180) 2813699..2814007 + 309 WP_038243514.1 hypothetical protein -
LNQ37_RS13195 (LNQ37_013185) 2814102..2814824 + 723 WP_071665694.1 fimbria/pilus periplasmic chaperone -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2813286..2813534 248


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-94)

Antitoxin

Antitoxin CbeA

(6-105)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10822.54 Da        Isoelectric Point: 6.4513

>T249490 WP_248578455.1 NZ_CP099811:2811848-2812135 [Yersinia ruckeri]
MKTLPATTPQAAKLCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDKTVIQEHIDAGISLSDAVNFLVEKYRLVRIDRKGF
SWQEQTPYISVVDIF

Download         Length: 288 bp

Antitoxin


Download         Length: 107 a.a.        Molecular weight: 12024.71 Da        Isoelectric Point: 7.7242

>AT249490 WP_248578456.1 NZ_CP099811:2811507-2811827 [Yersinia ruckeri]
MRSNVTWGLQRDITPRLGARLVQEGNRLHYLADRTSITGKFSEAECLKLNVVFPYFISQMESMLTTGEMNPRHAHCVTVY
HTGFTCEADTLGSCGYTYVAIYPTQR

Download         Length: 321 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References