Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 1864412..1865330 | Replicon | chromosome |
| Accession | NZ_CP099811 | ||
| Organism | Yersinia ruckeri strain NVI-9681 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | LNQ37_RS08325 | Protein ID | WP_038242633.1 |
| Coordinates | 1864872..1865330 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A085U7R3 |
| Locus tag | LNQ37_RS08320 | Protein ID | WP_038242631.1 |
| Coordinates | 1864412..1864858 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LNQ37_RS08300 (LNQ37_008295) | 1860110..1860814 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
| LNQ37_RS08305 (LNQ37_008300) | 1860825..1861799 | - | 975 | WP_038275966.1 | L-Ala-D/L-Glu epimerase | - |
| LNQ37_RS08310 (LNQ37_008305) | 1861949..1862452 | + | 504 | WP_248578091.1 | thiol peroxidase | - |
| LNQ37_RS08315 (LNQ37_008310) | 1862487..1864094 | - | 1608 | WP_038251390.1 | transcriptional regulator TyrR | - |
| LNQ37_RS08320 (LNQ37_008315) | 1864412..1864858 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
| LNQ37_RS08325 (LNQ37_008320) | 1864872..1865330 | + | 459 | WP_038242633.1 | RES domain-containing protein | Toxin |
| LNQ37_RS08330 (LNQ37_008325) | 1865334..1866392 | - | 1059 | WP_038242635.1 | YcjF family protein | - |
| LNQ37_RS08335 (LNQ37_008330) | 1866389..1867786 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
| LNQ37_RS08340 (LNQ37_008335) | 1867767..1868009 | - | 243 | WP_087931058.1 | phage shock protein PspD | - |
| LNQ37_RS08345 (LNQ37_008340) | 1868073..1868432 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
| LNQ37_RS08350 (LNQ37_008345) | 1868432..1868659 | - | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
| LNQ37_RS08355 (LNQ37_008350) | 1868743..1869408 | - | 666 | WP_004717561.1 | phage shock protein PspA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17072.55 Da Isoelectric Point: 6.6384
>T249485 WP_038242633.1 NZ_CP099811:1864872-1865330 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT249485 WP_038242631.1 NZ_CP099811:1864412-1864858 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|