Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 3157002..3157536 Replicon chromosome
Accession NZ_CP099809
Organism Yersinia ruckeri strain NVI-10587

Toxin (Protein)


Gene name relE Uniprot ID A0A0T9LYG3
Locus tag LNQ46_RS14465 Protein ID WP_038275268.1
Coordinates 3157002..3157292 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A1JJ37
Locus tag LNQ46_RS14470 Protein ID WP_005175264.1
Coordinates 3157282..3157536 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LNQ46_RS14415 (LNQ46_014410) 3152278..3152508 - 231 Protein_2795 DUF4942 domain-containing protein -
LNQ46_RS14420 (LNQ46_014415) 3152658..3152786 + 129 Protein_2796 helix-turn-helix domain-containing protein -
LNQ46_RS14425 (LNQ46_014420) 3152779..3152899 + 121 Protein_2797 transposase -
LNQ46_RS14430 (LNQ46_014425) 3152928..3153224 - 297 Protein_2798 integrase core domain-containing protein -
LNQ46_RS14435 (LNQ46_014430) 3153223..3153621 + 399 Protein_2799 integrase core domain-containing protein -
LNQ46_RS14440 (LNQ46_014435) 3153640..3153906 - 267 Protein_2800 hypothetical protein -
LNQ46_RS14445 (LNQ46_014440) 3153927..3154994 - 1068 WP_096823272.1 macro domain-containing protein -
LNQ46_RS14450 (LNQ46_014445) 3154991..3155647 - 657 WP_096823271.1 DUF4433 domain-containing protein -
LNQ46_RS14455 (LNQ46_014450) 3155650..3156225 - 576 WP_071706520.1 DarT ssDNA thymidine ADP-ribosyltransferase family protein -
LNQ46_RS14460 (LNQ46_014455) 3156349..3156738 - 390 WP_248578898.1 restriction endonuclease subunit S -
LNQ46_RS14465 (LNQ46_014460) 3157002..3157292 - 291 WP_038275268.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LNQ46_RS14470 (LNQ46_014465) 3157282..3157536 - 255 WP_005175264.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
LNQ46_RS14475 (LNQ46_014470) 3157710..3158969 - 1260 Protein_2807 integrase arm-type DNA-binding domain-containing protein -
LNQ46_RS14480 (LNQ46_014475) 3159483..3160427 + 945 WP_248578899.1 hypothetical protein -
LNQ46_RS14490 (LNQ46_014485) 3161953..3162393 - 441 WP_248578901.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3152928..3185208 32280
- flank IS/Tn - - 3152928..3153176 248


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11494.42 Da        Isoelectric Point: 9.9816

>T249483 WP_038275268.1 NZ_CP099809:c3157292-3157002 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ

Download         Length: 291 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9680.07 Da        Isoelectric Point: 4.8283

>AT249483 WP_005175264.1 NZ_CP099809:c3157536-3157282 [Yersinia ruckeri]
MSTIQIRVDDELKKSAYQAFEKLNLSPSDALRLFLRYVAENEKLPFSEVSVMVSNQDEDADILAVVRERLKNPAKRIRVN
IDDL

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0T9LYG3

Antitoxin

Source ID Structure
AlphaFold DB A1JJ37

References