Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 1919677..1920595 | Replicon | chromosome |
| Accession | NZ_CP099809 | ||
| Organism | Yersinia ruckeri strain NVI-10587 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | LNQ46_RS08635 | Protein ID | WP_038242633.1 |
| Coordinates | 1920137..1920595 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A085U7R3 |
| Locus tag | LNQ46_RS08630 | Protein ID | WP_038242631.1 |
| Coordinates | 1919677..1920123 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LNQ46_RS08610 (LNQ46_008605) | 1915375..1916079 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
| LNQ46_RS08615 (LNQ46_008610) | 1916090..1917064 | - | 975 | WP_248578615.1 | L-Ala-D/L-Glu epimerase | - |
| LNQ46_RS08620 (LNQ46_008615) | 1917214..1917717 | + | 504 | WP_004717547.1 | thiol peroxidase | - |
| LNQ46_RS08625 (LNQ46_008620) | 1917752..1919359 | - | 1608 | WP_038251390.1 | transcriptional regulator TyrR | - |
| LNQ46_RS08630 (LNQ46_008625) | 1919677..1920123 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
| LNQ46_RS08635 (LNQ46_008630) | 1920137..1920595 | + | 459 | WP_038242633.1 | RES domain-containing protein | Toxin |
| LNQ46_RS08640 (LNQ46_008635) | 1920599..1921657 | - | 1059 | WP_248578616.1 | YcjF family protein | - |
| LNQ46_RS08645 (LNQ46_008640) | 1921654..1923051 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
| LNQ46_RS08650 (LNQ46_008645) | 1923032..1923274 | - | 243 | WP_087931058.1 | phage shock protein PspD | - |
| LNQ46_RS08655 (LNQ46_008650) | 1923338..1923697 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
| LNQ46_RS08660 (LNQ46_008655) | 1923697..1923924 | - | 228 | WP_248578617.1 | envelope stress response membrane protein PspB | - |
| LNQ46_RS08665 (LNQ46_008660) | 1924008..1924673 | - | 666 | WP_004717561.1 | phage shock protein PspA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17072.55 Da Isoelectric Point: 6.6384
>T249476 WP_038242633.1 NZ_CP099809:1920137-1920595 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT249476 WP_038242631.1 NZ_CP099809:1919677-1920123 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|