Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 961714..962337 | Replicon | chromosome |
Accession | NZ_CP099809 | ||
Organism | Yersinia ruckeri strain NVI-10587 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A085U5C4 |
Locus tag | LNQ46_RS04295 | Protein ID | WP_038243726.1 |
Coordinates | 961714..961917 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A085U5C5 |
Locus tag | LNQ46_RS04300 | Protein ID | WP_004718732.1 |
Coordinates | 961969..962337 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNQ46_RS04270 (LNQ46_004270) | 957569..957907 | + | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
LNQ46_RS04275 (LNQ46_004275) | 957946..959235 | + | 1290 | WP_004718723.1 | ammonium transporter AmtB | - |
LNQ46_RS04280 (LNQ46_004280) | 959350..960213 | - | 864 | WP_248578737.1 | acyl-CoA thioesterase II | - |
LNQ46_RS04285 (LNQ46_004285) | 960591..960905 | - | 315 | WP_248577445.1 | MGMT family protein | - |
LNQ46_RS04295 (LNQ46_004295) | 961714..961917 | - | 204 | WP_038243726.1 | expression modulating protein YmoA | Toxin |
LNQ46_RS04300 (LNQ46_004300) | 961969..962337 | - | 369 | WP_004718732.1 | Hha toxicity modulator TomB | Antitoxin |
LNQ46_RS04305 (LNQ46_004305) | 963386..963547 | + | 162 | WP_004718735.1 | hypothetical protein | - |
LNQ46_RS04310 (LNQ46_004310) | 963666..963809 | - | 144 | WP_004718738.1 | type B 50S ribosomal protein L36 | - |
LNQ46_RS04315 (LNQ46_004315) | 963829..964083 | - | 255 | WP_038243728.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8037.27 Da Isoelectric Point: 6.4573
>T249475 WP_038243726.1 NZ_CP099809:c961917-961714 [Yersinia ruckeri]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.08 Da Isoelectric Point: 4.4225
>AT249475 WP_004718732.1 NZ_CP099809:c962337-961969 [Yersinia ruckeri]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C5 |