Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeV-yfjZ/CbtA-CbeA |
| Location | 545229..545951 | Replicon | chromosome |
| Accession | NZ_CP099809 | ||
| Organism | Yersinia ruckeri strain NVI-10587 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | LNQ46_RS02370 | Protein ID | WP_248578805.1 |
| Coordinates | 545631..545951 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | LNQ46_RS02365 | Protein ID | WP_248578840.1 |
| Coordinates | 545229..545564 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LNQ46_RS02340 (LNQ46_002340) | 540826..541680 | - | 855 | WP_248578686.1 | DNA adenine methylase | - |
| LNQ46_RS02345 (LNQ46_002345) | 541751..543220 | - | 1470 | WP_248578685.1 | hypothetical protein | - |
| LNQ46_RS02350 (LNQ46_002350) | 543496..543693 | + | 198 | Protein_452 | 50S ribosome-binding GTPase | - |
| LNQ46_RS02355 (LNQ46_002355) | 543755..544905 | + | 1151 | WP_087931031.1 | IS3 family transposase | - |
| LNQ46_RS02360 (LNQ46_002360) | 544925..545215 | + | 291 | Protein_454 | JAB domain-containing protein | - |
| LNQ46_RS02365 (LNQ46_002365) | 545229..545564 | + | 336 | WP_248578840.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LNQ46_RS02370 (LNQ46_002370) | 545631..545951 | + | 321 | WP_248578805.1 | TA system toxin CbtA family protein | Toxin |
| LNQ46_RS02375 (LNQ46_002375) | 546065..546898 | + | 834 | WP_248578806.1 | DUF4942 domain-containing protein | - |
| LNQ46_RS02380 (LNQ46_002380) | 547095..548174 | - | 1080 | WP_248578807.1 | tyrosine-type recombinase/integrase | - |
| LNQ46_RS02385 (LNQ46_002385) | 548174..548737 | - | 564 | WP_248578808.1 | PH domain-containing protein | - |
| LNQ46_RS02390 (LNQ46_002390) | 548763..549338 | - | 576 | WP_248578809.1 | phage repressor protein CI | - |
| LNQ46_RS02395 (LNQ46_002395) | 549456..549677 | + | 222 | WP_248578810.1 | regulator | - |
| LNQ46_RS02400 (LNQ46_002400) | 549709..550218 | + | 510 | WP_248578811.1 | phage regulatory CII family protein | - |
| LNQ46_RS02405 (LNQ46_002405) | 550226..550447 | + | 222 | WP_004717258.1 | DUF2724 domain-containing protein | - |
| LNQ46_RS02410 (LNQ46_002410) | 550434..550808 | + | 375 | WP_248578812.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | rfaE | 523447..608247 | 84800 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12056.64 Da Isoelectric Point: 5.0486
>T249473 WP_248578805.1 NZ_CP099809:545631-545951 [Yersinia ruckeri]
MQTTTVPATLPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDASIEEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQEQTPFLTATDILRAKRATGLMNT
MQTTTVPATLPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDASIEEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQEQTPFLTATDILRAKRATGLMNT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|