Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2992863..2993532 | Replicon | chromosome |
Accession | NZ_CP099808 | ||
Organism | Yersinia ruckeri strain NVI-11076 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | LNQ41_RS13730 | Protein ID | WP_045844283.1 |
Coordinates | 2992863..2993285 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | LNQ41_RS13735 | Protein ID | WP_004719196.1 |
Coordinates | 2993266..2993532 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNQ41_RS13710 (LNQ41_013705) | 2988702..2990435 | - | 1734 | WP_038276198.1 | single-stranded-DNA-specific exonuclease RecJ | - |
LNQ41_RS13715 (LNQ41_013710) | 2990442..2991158 | - | 717 | WP_071667006.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LNQ41_RS13720 (LNQ41_013715) | 2991190..2992089 | - | 900 | WP_004719193.1 | site-specific tyrosine recombinase XerD | - |
LNQ41_RS13725 (LNQ41_013720) | 2992197..2992715 | + | 519 | WP_038241022.1 | flavodoxin FldB | - |
LNQ41_RS13730 (LNQ41_013725) | 2992863..2993285 | - | 423 | WP_045844283.1 | protein YgfX | Toxin |
LNQ41_RS13735 (LNQ41_013730) | 2993266..2993532 | - | 267 | WP_004719196.1 | FAD assembly factor SdhE | Antitoxin |
LNQ41_RS13740 (LNQ41_013735) | 2993826..2994818 | + | 993 | WP_038241018.1 | tRNA-modifying protein YgfZ | - |
LNQ41_RS13745 (LNQ41_013740) | 2994957..2995622 | - | 666 | WP_175537887.1 | hemolysin III family protein | - |
LNQ41_RS13750 (LNQ41_013745) | 2995939..2996195 | + | 257 | Protein_2662 | HD domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16520.52 Da Isoelectric Point: 11.3725
>T249472 WP_045844283.1 NZ_CP099808:c2993285-2992863 [Yersinia ruckeri]
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGRRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGRRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|