Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 1935698..1936616 | Replicon | chromosome |
| Accession | NZ_CP099808 | ||
| Organism | Yersinia ruckeri strain NVI-11076 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | LNQ41_RS08710 | Protein ID | WP_248594018.1 |
| Coordinates | 1936158..1936616 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A085U7R3 |
| Locus tag | LNQ41_RS08705 | Protein ID | WP_038242631.1 |
| Coordinates | 1935698..1936144 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LNQ41_RS08685 (LNQ41_008680) | 1931396..1932100 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
| LNQ41_RS08690 (LNQ41_008685) | 1932111..1933085 | - | 975 | WP_071666721.1 | L-Ala-D/L-Glu epimerase | - |
| LNQ41_RS08695 (LNQ41_008690) | 1933235..1933738 | + | 504 | WP_004717547.1 | thiol peroxidase | - |
| LNQ41_RS08700 (LNQ41_008695) | 1933773..1935380 | - | 1608 | WP_038251390.1 | transcriptional regulator TyrR | - |
| LNQ41_RS08705 (LNQ41_008700) | 1935698..1936144 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
| LNQ41_RS08710 (LNQ41_008705) | 1936158..1936616 | + | 459 | WP_248594018.1 | RES domain-containing protein | Toxin |
| LNQ41_RS08715 (LNQ41_008710) | 1936620..1937678 | - | 1059 | WP_038242635.1 | YcjF family protein | - |
| LNQ41_RS08720 (LNQ41_008715) | 1937675..1939072 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
| LNQ41_RS08725 (LNQ41_008720) | 1939053..1939295 | - | 243 | WP_099511574.1 | phage shock protein PspD | - |
| LNQ41_RS08730 (LNQ41_008725) | 1939359..1939718 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
| LNQ41_RS08735 (LNQ41_008730) | 1939718..1939945 | - | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
| LNQ41_RS08740 (LNQ41_008735) | 1940029..1940694 | - | 666 | WP_004717561.1 | phage shock protein PspA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17068.56 Da Isoelectric Point: 6.6384
>T249467 WP_248594018.1 NZ_CP099808:1936158-1936616 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPPPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPPPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT249467 WP_038242631.1 NZ_CP099808:1935698-1936144 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|