Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 954559..955182 | Replicon | chromosome |
| Accession | NZ_CP099805 | ||
| Organism | Yersinia ruckeri strain NVI-10705 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A085U5C4 |
| Locus tag | LOR96_RS04330 | Protein ID | WP_038243726.1 |
| Coordinates | 954559..954762 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A085U5C5 |
| Locus tag | LOR96_RS04335 | Protein ID | WP_004718732.1 |
| Coordinates | 954814..955182 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOR96_RS04305 (LOR96_004300) | 950414..950752 | + | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
| LOR96_RS04310 (LOR96_004305) | 950791..952080 | + | 1290 | WP_004718723.1 | ammonium transporter AmtB | - |
| LOR96_RS04315 (LOR96_004310) | 952195..953058 | - | 864 | WP_004718726.1 | acyl-CoA thioesterase II | - |
| LOR96_RS04320 (LOR96_004315) | 953436..953750 | - | 315 | WP_004718728.1 | MGMT family protein | - |
| LOR96_RS04330 (LOR96_004325) | 954559..954762 | - | 204 | WP_038243726.1 | expression modulating protein YmoA | Toxin |
| LOR96_RS04335 (LOR96_004330) | 954814..955182 | - | 369 | WP_004718732.1 | Hha toxicity modulator TomB | Antitoxin |
| LOR96_RS04340 (LOR96_004335) | 956255..956392 | + | 138 | WP_155274690.1 | hypothetical protein | - |
| LOR96_RS04345 (LOR96_004340) | 956511..956654 | - | 144 | WP_004718738.1 | type B 50S ribosomal protein L36 | - |
| LOR96_RS04350 (LOR96_004345) | 956674..956928 | - | 255 | WP_038243728.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8037.27 Da Isoelectric Point: 6.4573
>T249455 WP_038243726.1 NZ_CP099805:c954762-954559 [Yersinia ruckeri]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.08 Da Isoelectric Point: 4.4225
>AT249455 WP_004718732.1 NZ_CP099805:c955182-954814 [Yersinia ruckeri]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085U5C4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085U5C5 |