Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2372494..2373469 | Replicon | chromosome |
Accession | NZ_CP099801 | ||
Organism | Bacillus paranthracis strain SSBC101 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | B7HS47 |
Locus tag | NHM99_RS12250 | Protein ID | WP_002027714.1 |
Coordinates | 2372494..2373231 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | R8HWP4 |
Locus tag | NHM99_RS12255 | Protein ID | WP_000588712.1 |
Coordinates | 2373344..2373469 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHM99_RS12220 (NHM99_12220) | 2367569..2368279 | + | 711 | WP_000787481.1 | class I SAM-dependent methyltransferase | - |
NHM99_RS12225 (NHM99_12225) | 2368399..2368806 | + | 408 | WP_000072484.1 | VOC family protein | - |
NHM99_RS12230 (NHM99_12230) | 2368912..2369004 | + | 93 | Protein_2333 | methyltransferase | - |
NHM99_RS12235 (NHM99_12235) | 2369126..2370811 | - | 1686 | WP_002027713.1 | alpha-keto acid decarboxylase family protein | - |
NHM99_RS12240 (NHM99_12240) | 2370918..2371400 | + | 483 | WP_000191904.1 | MarR family transcriptional regulator | - |
NHM99_RS12245 (NHM99_12245) | 2371568..2372305 | + | 738 | WP_000594123.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
NHM99_RS12250 (NHM99_12250) | 2372494..2373231 | + | 738 | WP_002027714.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NHM99_RS12255 (NHM99_12255) | 2373344..2373469 | + | 126 | WP_000588712.1 | hypothetical protein | Antitoxin |
NHM99_RS12260 (NHM99_12260) | 2373545..2373721 | + | 177 | WP_000852618.1 | stage II sporulation protein SB | - |
NHM99_RS12265 (NHM99_12265) | 2373865..2375334 | + | 1470 | WP_000287521.1 | beta-Ala-His dipeptidase | - |
NHM99_RS12270 (NHM99_12270) | 2375411..2375782 | - | 372 | WP_000670600.1 | DUF5065 family protein | - |
NHM99_RS12275 (NHM99_12275) | 2375925..2376518 | + | 594 | WP_253130388.1 | SGNH/GDSL hydrolase family protein | - |
NHM99_RS12280 (NHM99_12280) | 2376740..2377273 | + | 534 | WP_000438318.1 | sigma-70 family RNA polymerase sigma factor | - |
NHM99_RS12285 (NHM99_12285) | 2377263..2378090 | + | 828 | WP_001060779.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28415.15 Da Isoelectric Point: 8.2672
>T249452 WP_002027714.1 NZ_CP099801:2372494-2373231 [Bacillus paranthracis]
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTSIIQNVNPVVFGTMEWHTEEEYTKSLNVFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTSIIQNVNPVVFGTMEWHTEEEYTKSLNVFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5M9H7T3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366GQT1 |