Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 249720..250362 | Replicon | chromosome |
Accession | NZ_CP099801 | ||
Organism | Bacillus paranthracis strain SSBC101 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NHM99_RS01395 | Protein ID | WP_253130004.1 |
Coordinates | 250012..250362 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | NHM99_RS01390 | Protein ID | WP_000004570.1 |
Coordinates | 249720..250007 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHM99_RS01365 (NHM99_01365) | 245044..246006 | + | 963 | WP_000961151.1 | UV DNA damage repair endonuclease UvsE | - |
NHM99_RS01370 (NHM99_01370) | 245999..246571 | - | 573 | WP_000906919.1 | rhomboid family intramembrane serine protease | - |
NHM99_RS01375 (NHM99_01375) | 246664..247023 | + | 360 | WP_000635037.1 | holo-ACP synthase | - |
NHM99_RS01380 (NHM99_01380) | 247180..248130 | + | 951 | WP_025991724.1 | outer membrane lipoprotein carrier protein LolA | - |
NHM99_RS01385 (NHM99_01385) | 248249..249418 | + | 1170 | WP_000390601.1 | alanine racemase | - |
NHM99_RS01390 (NHM99_01390) | 249720..250007 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
NHM99_RS01395 (NHM99_01395) | 250012..250362 | + | 351 | WP_253130004.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NHM99_RS01400 (NHM99_01400) | 250430..252598 | + | 2169 | WP_000450602.1 | Tex family protein | - |
NHM99_RS01405 (NHM99_01405) | 252656..252772 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
NHM99_RS01410 (NHM99_01410) | 252968..253426 | + | 459 | WP_000344246.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13008.14 Da Isoelectric Point: 5.7168
>T249451 WP_253130004.1 NZ_CP099801:250012-250362 [Bacillus paranthracis]
MFVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MFVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|