Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4718247..4718855 | Replicon | chromosome |
Accession | NZ_CP099798 | ||
Organism | Pseudomonas aeruginosa strain PAO1-L |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | NHZ68_RS21845 | Protein ID | WP_003114156.1 |
Coordinates | 4718247..4718594 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | NHZ68_RS21850 | Protein ID | WP_003114155.1 |
Coordinates | 4718604..4718855 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHZ68_RS21815 (NHZ68_21815) | 4713606..4713878 | + | 273 | WP_010895521.1 | cysteine-rich CWC family protein | - |
NHZ68_RS21820 (NHZ68_21820) | 4713878..4714570 | + | 693 | WP_003114159.1 | 16S rRNA pseudouridine(516) synthase | - |
NHZ68_RS21825 (NHZ68_21825) | 4714706..4715749 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
NHZ68_RS21830 (NHZ68_21830) | 4715829..4716566 | + | 738 | WP_003114158.1 | murein L,D-transpeptidase catalytic domain family protein | - |
NHZ68_RS21835 (NHZ68_21835) | 4717018..4717920 | + | 903 | WP_003114157.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
NHZ68_RS21845 (NHZ68_21845) | 4718247..4718594 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NHZ68_RS21850 (NHZ68_21850) | 4718604..4718855 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NHZ68_RS21855 (NHZ68_21855) | 4719069..4720052 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
NHZ68_RS21860 (NHZ68_21860) | 4720052..4721344 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
NHZ68_RS21865 (NHZ68_21865) | 4721574..4722848 | - | 1275 | WP_010895520.1 | zonular occludens toxin family protein | - |
NHZ68_RS21870 (NHZ68_21870) | 4722852..4723208 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 4718247..4740445 | 22198 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T249449 WP_003114156.1 NZ_CP099798:c4718594-4718247 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |