Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
| Location | 4718272..4718880 | Replicon | chromosome |
| Accession | NZ_CP099797 | ||
| Organism | Pseudomonas aeruginosa strain PAO1-N | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | Q9I5J9 |
| Locus tag | NHZ69_RS21850 | Protein ID | WP_003114156.1 |
| Coordinates | 4718272..4718619 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | A0A0B0C355 |
| Locus tag | NHZ69_RS21855 | Protein ID | WP_003114155.1 |
| Coordinates | 4718629..4718880 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHZ69_RS21820 (NHZ69_21820) | 4713631..4713903 | + | 273 | WP_010895521.1 | cysteine-rich CWC family protein | - |
| NHZ69_RS21825 (NHZ69_21825) | 4713903..4714595 | + | 693 | WP_003114159.1 | 16S rRNA pseudouridine(516) synthase | - |
| NHZ69_RS21830 (NHZ69_21830) | 4714731..4715774 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
| NHZ69_RS21835 (NHZ69_21835) | 4715854..4716591 | + | 738 | WP_003114158.1 | murein L,D-transpeptidase catalytic domain family protein | - |
| NHZ69_RS21840 (NHZ69_21840) | 4717043..4717945 | + | 903 | WP_003114157.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
| NHZ69_RS21850 (NHZ69_21850) | 4718272..4718619 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NHZ69_RS21855 (NHZ69_21855) | 4718629..4718880 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NHZ69_RS21860 (NHZ69_21860) | 4719094..4720077 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
| NHZ69_RS21865 (NHZ69_21865) | 4720077..4721369 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
| NHZ69_RS21870 (NHZ69_21870) | 4721599..4722873 | - | 1275 | WP_010895520.1 | zonular occludens toxin family protein | - |
| NHZ69_RS21875 (NHZ69_21875) | 4722877..4723233 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4718272..4746669 | 28397 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T249442 WP_003114156.1 NZ_CP099797:c4718619-4718272 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9I5J9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B0C355 |