Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4565023..4565855 | Replicon | chromosome |
| Accession | NZ_CP099754 | ||
| Organism | Escherichia coli strain 806883-9-2019 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | NH020_RS22050 | Protein ID | WP_000854753.1 |
| Coordinates | 4565481..4565855 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | NH020_RS22045 | Protein ID | WP_001540478.1 |
| Coordinates | 4565023..4565391 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH020_RS22010 (4560855) | 4560855..4561535 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| NH020_RS22015 (4561683) | 4561683..4562360 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| NH020_RS22020 (4562366) | 4562366..4562599 | + | 234 | WP_001278283.1 | DUF905 family protein | - |
| NH020_RS22025 (4562689) | 4562689..4563507 | + | 819 | WP_023909075.1 | DUF932 domain-containing protein | - |
| NH020_RS22030 (4563599) | 4563599..4564084 | + | 486 | WP_001586019.1 | antirestriction protein | - |
| NH020_RS22035 (4564100) | 4564100..4564576 | + | 477 | WP_001186773.1 | RadC family protein | - |
| NH020_RS22040 (4564639) | 4564639..4564860 | + | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| NH020_RS22045 (4565023) | 4565023..4565391 | + | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NH020_RS22050 (4565481) | 4565481..4565855 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| NH020_RS22055 (4565852) | 4565852..4566340 | + | 489 | WP_000777545.1 | DUF5983 family protein | - |
| NH020_RS22060 (4566352) | 4566352..4566549 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| NH020_RS22065 (4566646) | 4566646..4567215 | + | 570 | WP_001290252.1 | DUF4942 domain-containing protein | - |
| NH020_RS22070 (4567964) | 4567964..4569502 | + | 1539 | WP_023908864.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4552906..4577315 | 24409 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T249431 WP_000854753.1 NZ_CP099754:4565481-4565855 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT249431 WP_001540478.1 NZ_CP099754:4565023-4565391 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |