Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4431663..4432258 | Replicon | chromosome |
Accession | NZ_CP099754 | ||
Organism | Escherichia coli strain 806883-9-2019 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | NH020_RS21350 | Protein ID | WP_000239581.1 |
Coordinates | 4431663..4432013 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | NH020_RS21355 | Protein ID | WP_001223213.1 |
Coordinates | 4432007..4432258 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH020_RS21330 (4427117) | 4427117..4428139 | - | 1023 | WP_001298067.1 | ABC transporter permease | - |
NH020_RS21335 (4428153) | 4428153..4429655 | - | 1503 | WP_022646474.1 | sugar ABC transporter ATP-binding protein | - |
NH020_RS21340 (4429788) | 4429788..4430744 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
NH020_RS21345 (4431054) | 4431054..4431584 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
NH020_RS21350 (4431663) | 4431663..4432013 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
NH020_RS21355 (4432007) | 4432007..4432258 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
NH020_RS21360 (4432470) | 4432470..4432811 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
NH020_RS21365 (4432814) | 4432814..4436593 | - | 3780 | WP_022646473.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T249430 WP_000239581.1 NZ_CP099754:c4432013-4431663 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|