Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4249831..4250381 Replicon chromosome
Accession NZ_CP099754
Organism Escherichia coli strain 806883-9-2019

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag NH020_RS20450 Protein ID WP_001160966.1
Coordinates 4249831..4250145 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag NH020_RS20455 Protein ID WP_000125568.1
Coordinates 4250148..4250381 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NH020_RS20425 (4245506) 4245506..4246792 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
NH020_RS20430 (4246792) 4246792..4247781 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NH020_RS20435 (4247778) 4247778..4248599 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NH020_RS20440 (4248602) 4248602..4248979 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NH020_RS20445 (4248986) 4248986..4249834 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NH020_RS20450 (4249831) 4249831..4250145 - 315 WP_001160966.1 CcdB family protein Toxin
NH020_RS20455 (4250148) 4250148..4250381 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NH020_RS20460 (4250467) 4250467..4250946 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
NH020_RS20465 (4251138) 4251138..4253000 - 1863 WP_022645165.1 glutathione-regulated potassium-efflux system protein KefC -
NH020_RS20470 (4252993) 4252993..4253523 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NH020_RS20475 (4253631) 4253631..4254962 - 1332 WP_001183201.1 MFS transporter -
NH020_RS20480 (4255020) 4255020..4255307 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T249428 WP_001160966.1 NZ_CP099754:c4250145-4249831 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT249428 WP_000125568.1 NZ_CP099754:c4250381-4250148 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References