Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3335781..3336486 | Replicon | chromosome |
Accession | NZ_CP099754 | ||
Organism | Escherichia coli strain 806883-9-2019 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | NH020_RS16020 | Protein ID | WP_000539521.1 |
Coordinates | 3335781..3336167 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NH020_RS16025 | Protein ID | WP_001280945.1 |
Coordinates | 3336157..3336486 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH020_RS16000 (3331785) | 3331785..3332411 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
NH020_RS16005 (3332408) | 3332408..3333523 | - | 1116 | WP_000554964.1 | aldose sugar dehydrogenase YliI | - |
NH020_RS16010 (3333634) | 3333634..3334017 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
NH020_RS16015 (3334230) | 3334230..3335555 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
NH020_RS16020 (3335781) | 3335781..3336167 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NH020_RS16025 (3336157) | 3336157..3336486 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
NH020_RS16030 (3336556) | 3336556..3337884 | - | 1329 | WP_022645414.1 | GGDEF domain-containing protein | - |
NH020_RS16035 (3337892) | 3337892..3340240 | - | 2349 | WP_022645413.1 | EAL domain-containing protein | - |
NH020_RS16040 (3340417) | 3340417..3341328 | - | 912 | WP_044781989.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T249424 WP_000539521.1 NZ_CP099754:3335781-3336167 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|