Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2645907..2646545 | Replicon | chromosome |
| Accession | NZ_CP099754 | ||
| Organism | Escherichia coli strain 806883-9-2019 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NH020_RS12595 | Protein ID | WP_000813794.1 |
| Coordinates | 2646369..2646545 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NH020_RS12590 | Protein ID | WP_001270286.1 |
| Coordinates | 2645907..2646323 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH020_RS12570 (2641059) | 2641059..2642000 | - | 942 | WP_022645667.1 | ABC transporter permease | - |
| NH020_RS12575 (2642001) | 2642001..2643014 | - | 1014 | WP_022645666.1 | ABC transporter ATP-binding protein | - |
| NH020_RS12580 (2643032) | 2643032..2644177 | - | 1146 | WP_000047466.1 | ABC transporter substrate-binding protein | - |
| NH020_RS12585 (2644422) | 2644422..2645828 | - | 1407 | WP_022645665.1 | PLP-dependent aminotransferase family protein | - |
| NH020_RS12590 (2645907) | 2645907..2646323 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NH020_RS12595 (2646369) | 2646369..2646545 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NH020_RS12600 (2646767) | 2646767..2646997 | + | 231 | WP_000491567.1 | DUF2554 family protein | - |
| NH020_RS12605 (2647089) | 2647089..2649050 | - | 1962 | WP_023909195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NH020_RS12610 (2649123) | 2649123..2649659 | - | 537 | WP_000429148.1 | DNA-binding transcriptional regulator SutR | - |
| NH020_RS12615 (2649712) | 2649712..2650923 | + | 1212 | WP_071788120.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T249422 WP_000813794.1 NZ_CP099754:c2646545-2646369 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT249422 WP_001270286.1 NZ_CP099754:c2646323-2645907 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|