Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1141567..1142150 | Replicon | chromosome |
| Accession | NZ_CP099754 | ||
| Organism | Escherichia coli strain 806883-9-2019 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NH020_RS05440 | Protein ID | WP_023908984.1 |
| Coordinates | 1141815..1142150 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | NH020_RS05435 | Protein ID | WP_000581937.1 |
| Coordinates | 1141567..1141815 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH020_RS05425 (1137906) | 1137906..1139207 | + | 1302 | WP_000046818.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| NH020_RS05430 (1139255) | 1139255..1141489 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| NH020_RS05435 (1141567) | 1141567..1141815 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NH020_RS05440 (1141815) | 1141815..1142150 | + | 336 | WP_023908984.1 | endoribonuclease MazF | Toxin |
| NH020_RS05445 (1142222) | 1142222..1143013 | + | 792 | WP_001071641.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NH020_RS05450 (1143241) | 1143241..1144878 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| NH020_RS05455 (1144965) | 1144965..1146263 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12082.92 Da Isoelectric Point: 8.2618
>T249417 WP_023908984.1 NZ_CP099754:1141815-1142150 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCQCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCQCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|