Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 990901..991555 | Replicon | chromosome |
| Accession | NZ_CP099754 | ||
| Organism | Escherichia coli strain 806883-9-2019 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NH020_RS04770 | Protein ID | WP_000244781.1 |
| Coordinates | 991148..991555 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NH020_RS04765 | Protein ID | WP_000354046.1 |
| Coordinates | 990901..991167 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH020_RS04745 (986979) | 986979..988412 | - | 1434 | WP_022646090.1 | 6-phospho-beta-glucosidase BglA | - |
| NH020_RS04750 (988457) | 988457..988768 | + | 312 | WP_001182953.1 | N(4)-acetylcytidine aminohydrolase | - |
| NH020_RS04755 (988932) | 988932..989591 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| NH020_RS04760 (989668) | 989668..990648 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
| NH020_RS04765 (990901) | 990901..991167 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NH020_RS04770 (991148) | 991148..991555 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NH020_RS04775 (991595) | 991595..992116 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NH020_RS04780 (992228) | 992228..993124 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NH020_RS04785 (993149) | 993149..993859 | + | 711 | WP_000715222.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NH020_RS04790 (993865) | 993865..995598 | + | 1734 | WP_000813233.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T249416 WP_000244781.1 NZ_CP099754:991148-991555 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|