Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 857446..858281 | Replicon | chromosome |
| Accession | NZ_CP099754 | ||
| Organism | Escherichia coli strain 806883-9-2019 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NH020_RS04055 | Protein ID | WP_260584502.1 |
| Coordinates | 857446..857823 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7Z1I923 |
| Locus tag | NH020_RS04060 | Protein ID | WP_016231183.1 |
| Coordinates | 857913..858281 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH020_RS04025 (852560) | 852560..853708 | - | 1149 | WP_000905926.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| NH020_RS04030 (853780) | 853780..854763 | - | 984 | WP_001298261.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| NH020_RS04035 (855574) | 855574..855744 | - | 171 | Protein_793 | IS110 family transposase | - |
| NH020_RS04040 (856086) | 856086..856655 | - | 570 | WP_001290252.1 | DUF4942 domain-containing protein | - |
| NH020_RS04045 (856752) | 856752..856949 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| NH020_RS04050 (856961) | 856961..857449 | - | 489 | WP_260584500.1 | DUF5983 family protein | - |
| NH020_RS04055 (857446) | 857446..857823 | - | 378 | WP_260584502.1 | toxin | Toxin |
| NH020_RS04060 (857913) | 857913..858281 | - | 369 | WP_016231183.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NH020_RS04065 (858331) | 858331..858975 | - | 645 | WP_214148035.1 | antitoxin of toxin-antitoxin stability system | - |
| NH020_RS04070 (858994) | 858994..859215 | - | 222 | WP_016231182.1 | DUF987 domain-containing protein | - |
| NH020_RS04075 (859278) | 859278..859754 | - | 477 | WP_001186746.1 | RadC family protein | - |
| NH020_RS04080 (859770) | 859770..860255 | - | 486 | WP_064277104.1 | antirestriction protein | - |
| NH020_RS04085 (860310) | 860310..861128 | - | 819 | WP_023909039.1 | DUF932 domain-containing protein | - |
| NH020_RS04090 (861228) | 861228..861461 | - | 234 | WP_001119719.1 | DUF905 family protein | - |
| NH020_RS04095 (861547) | 861547..861951 | + | 405 | WP_016231180.1 | transposase | - |
| NH020_RS04100 (861948) | 861948..862295 | + | 348 | WP_000612617.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14036.96 Da Isoelectric Point: 7.8045
>T249415 WP_260584502.1 NZ_CP099754:c857823-857446 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13613.43 Da Isoelectric Point: 6.8413
>AT249415 WP_016231183.1 NZ_CP099754:c858281-857913 [Escherichia coli]
MSDTLPGTTLPDNNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
MSDTLPGTTLPDNNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|