Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 166866..167478 | Replicon | chromosome |
| Accession | NZ_CP099754 | ||
| Organism | Escherichia coli strain 806883-9-2019 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9YXE2 |
| Locus tag | NH020_RS00725 | Protein ID | WP_000833473.1 |
| Coordinates | 166866..167051 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A0A1AGA0 |
| Locus tag | NH020_RS00730 | Protein ID | WP_022646255.1 |
| Coordinates | 167068..167478 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH020_RS00710 (162332) | 162332..163627 | + | 1296 | WP_000985736.1 | Fic family protein | - |
| NH020_RS00715 (163735) | 163735..165273 | + | 1539 | WP_000183976.1 | aldehyde dehydrogenase AldB | - |
| NH020_RS00720 (165314) | 165314..166393 | - | 1080 | WP_000061477.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| NH020_RS00725 (166866) | 166866..167051 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NH020_RS00730 (167068) | 167068..167478 | + | 411 | WP_022646255.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NH020_RS00735 (167590) | 167590..169569 | - | 1980 | WP_022646254.1 | glycoside hydrolase family 127 protein | - |
| NH020_RS00740 (169580) | 169580..170980 | - | 1401 | WP_001600688.1 | MFS transporter | - |
| NH020_RS00745 (171206) | 171206..172021 | + | 816 | WP_022646253.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T249413 WP_000833473.1 NZ_CP099754:166866-167051 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15214.08 Da Isoelectric Point: 4.4482
>AT249413 WP_022646255.1 NZ_CP099754:167068-167478 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALAAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALAAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9YXE2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1AGA0 |