Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4288231..4288856 | Replicon | chromosome |
| Accession | NZ_CP099752 | ||
| Organism | Escherichia coli strain 806883-11-2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | NHF43_RS20605 | Protein ID | WP_000911329.1 |
| Coordinates | 4288458..4288856 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NHF43_RS20600 | Protein ID | WP_000450524.1 |
| Coordinates | 4288231..4288458 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF43_RS20575 (4284033) | 4284033..4284503 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| NHF43_RS20580 (4284503) | 4284503..4285075 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NHF43_RS20585 (4285221) | 4285221..4286099 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NHF43_RS20590 (4286116) | 4286116..4287150 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| NHF43_RS20595 (4287363) | 4287363..4288076 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NHF43_RS20600 (4288231) | 4288231..4288458 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NHF43_RS20605 (4288458) | 4288458..4288856 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NHF43_RS20610 (4289003) | 4289003..4289866 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| NHF43_RS20615 (4289881) | 4289881..4291896 | + | 2016 | WP_028985187.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NHF43_RS20620 (4291970) | 4291970..4292668 | + | 699 | WP_000679812.1 | esterase | - |
| NHF43_RS20625 (4292778) | 4292778..4292978 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T249411 WP_000911329.1 NZ_CP099752:4288458-4288856 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |