Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3993541..3994124 | Replicon | chromosome |
Accession | NZ_CP099752 | ||
Organism | Escherichia coli strain 806883-11-2019 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | NHF43_RS19180 | Protein ID | WP_000254738.1 |
Coordinates | 3993789..3994124 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NHF43_RS19175 | Protein ID | WP_000581937.1 |
Coordinates | 3993541..3993789 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHF43_RS19165 (3989880) | 3989880..3991181 | + | 1302 | WP_000046804.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
NHF43_RS19170 (3991229) | 3991229..3993463 | + | 2235 | WP_000226827.1 | GTP diphosphokinase | - |
NHF43_RS19175 (3993541) | 3993541..3993789 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NHF43_RS19180 (3993789) | 3993789..3994124 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
NHF43_RS19185 (3994195) | 3994195..3994986 | + | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NHF43_RS19190 (3995214) | 3995214..3996851 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NHF43_RS19195 (3996939) | 3996939..3998237 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T249410 WP_000254738.1 NZ_CP099752:3993789-3994124 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|