Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3857310..3857964 | Replicon | chromosome |
| Accession | NZ_CP099752 | ||
| Organism | Escherichia coli strain 806883-11-2019 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | NHF43_RS18570 | Protein ID | WP_000244777.1 |
| Coordinates | 3857557..3857964 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NHF43_RS18565 | Protein ID | WP_000354046.1 |
| Coordinates | 3857310..3857576 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF43_RS18540 (3852479) | 3852479..3853222 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| NHF43_RS18545 (3853279) | 3853279..3854712 | - | 1434 | WP_001307385.1 | 6-phospho-beta-glucosidase BglA | - |
| NHF43_RS18550 (3854757) | 3854757..3855068 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| NHF43_RS18555 (3855232) | 3855232..3855891 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NHF43_RS18560 (3856087) | 3856087..3857067 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| NHF43_RS18565 (3857310) | 3857310..3857576 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NHF43_RS18570 (3857557) | 3857557..3857964 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
| NHF43_RS18575 (3858004) | 3858004..3858525 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NHF43_RS18580 (3858637) | 3858637..3859533 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NHF43_RS18585 (3859558) | 3859558..3860268 | + | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NHF43_RS18590 (3860274) | 3860274..3862007 | + | 1734 | WP_000813223.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T249409 WP_000244777.1 NZ_CP099752:3857557-3857964 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |